Loading...
HomeMy WebLinkAbout2026-253-E-AMS-Vaughan Electric-ES - Replace Exterior Lighting, Passmore Add Exterior Lighting Revised 01/24 1 [Departmental Use Only] TITLE ES/Passmore Ext Light FY 2025-2026 RFP5474 NORTH CAROLINA CONSTRUCTION AGREEMENT UNDER $250,000.00 ORANGE COUNTY THIS CONSTRUCTION AGREEMENT (hereinafter called “Agreement”), made as of the 18th day of May, 2026, by and between Vaughan Electric Co., Inc., (hereinafter called the “Contractor”), and Orange County, a political subdivision of the State of North Carolina, (hereinafter called the “County,” “Orange County,” or “Owner”). W I T N E S S E T H: That the Contractor and the Owner, for the consideration herein named, agree as follows: 1. CONTRACT DOCUMENTS; PRIORITY The Contract Documents consist of this Agreement, the Request for Proposals, Proposal, Construction Drawings, and Written Specifications. The Contract Documents form the Contract. In the event of any inconsistency between or among the Contract Documents the Contract Documents shall be interpreted in the following order of priority: a. This Agreement. b. Designer Approved Bulletins and Field Orders. c. Request for Proposals and addenda thereto. d. Proposal. 2. SCOPE OF WORK The Contractor shall furnish and deliver all of the materials, and perform all of the work required by this Agreement within the time period stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner and in accordance with the following enumerated documents, which are made a part hereof as if fully contained herein: a. Construction Drawings prepared by Progressive Design Collaborative LTD (Sheet Passmore Center Exterior Lighting G1.01, E0.00, E1.01, E1.02, E1.03 and Specifications dated 06/19/2025, Emergency Services Exterior Lighting drawing E-1 and Specifications dated 06/09/2025) b. Written specifications prepared by the project engineer. c. Vaughan Electric Co., Inc. proposal dated March 31, 2026 which fully describes the work to be performed. Such work will hereafter be called the “Work”. d. Related documents listed under Section 1 above. 3. TERM AND SCHEDULING Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 2 a. The Contractor agrees to commence work pursuant to the written Notice to Proceed. b. The Contractor agrees to complete substantially all Work by Demember 30, 2026. c. Time is of the essence with respect to all dates specified in the Contract Documents as Completion Dates. d. The Contractor shall perform the Work in the time, manner, and form required by the Contract Documents and as stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner. e. It is expressly understood that the Owner will employ other contractors to perform work as a part of the Project whose work will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate its activities with such other contractors, particularly with respect to access to work areas, storage of materials and other common facilities. f. Should the Owner determine that the Contractor is behind schedule Owner may require, at no additional cost to the Owner, the Contractor to expedite and accelerate its efforts, including providing additional resources and working overtime, as necessary, to perform the Work in accordance with the approved project schedule. 4. STANDARD OF CARE a. The Contractor shall exercise reasonable care and diligence in performing the Work in accordance with the highest generally accepted standards of this type of Contractor practice throughout the United States and in accordance with applicable federal, state and local laws and regulations applicable to the performance of these services. Contractor is solely responsible for the professional quality, accuracy and timely completion and submission of all work. b. The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance or configuration. c. Contractor shall be responsible for all errors or omissions caused by its employees, agents, contractors, or assigns in the performance of the Agreement. Contractor shall correct any and all errors, omissions, discrepancies, ambiguities, mistakes or conflicts at no additional cost to the Owner. d. Contractor is an independent contractor of Owner. Any and all employees of the Contractor engaged by the Contractor in the performance of any work or services required of the Contractor under this Agreement, shall be considered employees or agents of the Contractor only and not of the Owner, and any and all claims that may or might arise under any workers compensation or other law or contract on behalf of said employees while so engaged shall be the sole obligation and responsibility of the Contractor. e. If activities related to the performance of this Agreement require specific licenses, certifications, or related credentials Contractor represents that it or its employees, agents and subcontractors engaged in such activities possess such licenses, certifications, or Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 3 credentials and that such licenses certifications, or credentials are current, active, and not in a state of suspension or revocation. f. The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor and Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, or control, and all such property while it is in transit. g. The Contractor is solely responsible for obtaining all permits necessary to complete the Work in compliance with all local, state, and federal laws. 5. PAYMENT & TAXES a. The Owner hereby agrees to pay to the Contractor for the faithful performance of this Agreement and the Contractor hereby agrees to perform all of the Work for a sum not-to- exceed Forty-Four Thousand, Five Hundred Dollars ($44,500.00). Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Owner ’s Representative, generally the architect if an architect is retained on the Work, a Request for Payment for work done during the previous calendar month. i. The Request for Payment shall be in form of a standardized invoice or AIA Document G702-703 appropriately addressed to Owner’s Representative at PO Box 8181, Hillsborough, NC 27278 and shall show substantially the value of work done during the previous calendar month. ii. The amount due for payment shall be ninety-five percent (95%) of the value of work completed since the last Request for Payment and this amount shall be paid by the Owner on or before the last business day of the month. Owner shall retain five percent (5%). 1. Upon Owner’s Representative’s certification that ninety percent (90%) of the Work has been satisfactorily completed retainage may be discontinued. Retainage may be discontinued, at Owner’s Discretion, so long as work continues to be completed satisfactorily and on schedule. iii. Final payment shall not be due to the Contractor until thirty (30) days after one hundred percent (100%) of the Work, including punch list work, has been satisfactorily (as determined by the County) completed and an appropriate affidavit as required in Section 7(c) below has been received by Owner. b. Should Owner reasonably determine that Contractor has failed to perform the Work related to a Request for Payment, Owner, at its discretion may provide the Contractor ten (10) days to cure the breach. Owner may withhold the accompanying payment without penalty until such time as Contractor cures the breach. i. Should Contractor or its representatives fail to cure the breach within ten (10) days, or fail to reasonably agree to such modified schedule, Owner may immediately terminate this Agreement in writing, without penalty or incurring further obligation to Contractor. ii. This section shall not be interpreted to limit the definition of breach to the failure to perform the Work related to a Request for Payment. c. The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. It shall be the Contractor's Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 4 responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of its subcontractors. 6. INSURANCE AND BONDS a. Minimum requirements – Contractor shall obtain, at its sole expense, Commercial General Liability Insurance, Automobile Insurance, Workers’ Compensation Insurance, and any additional insurance as may be required by Owner’s Risk Manager as such insurance requirements are described in the Orange County Risk Transfer Policy and Orange County Minimum Insurance Coverage Requirements (each document is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). If Owner’s Risk Manager determines additional insurance coverage is required such additional insurance shall be designated here NA (if no additional insurance required mark N/A as being not applicable). Contractor shall not commence construction work until such insurance is in effect and certification thereof has been received by the Owner's Risk Manager. b. Performance Bonds – Contractor shall furnish bonds covering the faithful performance of the Contract and payment of all obligations arising under any of the Contract Documents or related in any way to the Work. Contractor shall immediately furnish a copy of such bonds to any requesting person who appears to be a potential beneficiary of bonds covering payment obligations arising under any of the Contract Documents. This subsection 6(b) applies only to Contracts of fifty thousand dollars ($50,000.00) or more where the total cost for the project is three hundred thousand dollars ($300,000.00) or more. 7. INDEMNITY a. To the extent authorized by North Carolina law the Contractor shall indemnify, without limitation, and hold harmless to the maximum extent permitted by law the Owner and its agents and employees from and against any and all claims, damages, losses and expenses, including attorney's fees, arising out of or resulting from the performance or nonperformance of the Work, provided that any such claim, damages, loss or expense (A) is attributable to bodily injury, sickness, disease or death or injury to, or destruction of, property, including the loss of use resulting therefrom; and (B) is caused in whole or in part by any breach of any provision of the Agreement or by any negligent or wrongful act or omission of the Contractor, any Subcontractor, or supplier of the Contractor, anyone directly or indirectly employed by any of them or anyone for whose acts any of them may be liable. The indemnification obligation under this paragraph shall not be limited in any way by any limitation of the amount or type of damages, compensation or benefits payable by or for the Contractor or any subcontractor under workers' compensation acts, disability benefits acts or other employee benefit acts. It is the intent of this section that the Contractor shall indemnify the County to the maximum extent allowed by law. b. The Contractor shall indemnify and hold harmless Owner from any lien of whatever type through the purchase of appropriate bonds and insurance as designated in Section 6 above. In the event any such lien is filed against Owner’s property Contractor shall, through such bonds and insurance or at Contractors expense, defend Owner against all such claims of lien. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 5 c. Upon completion of the Work the Contractor shall execute an affidavit stating there are no unpaid debts for any work that has been done or materials that have been furnished to the project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such debts and liens. Such indemnification shall be in a form and substance acceptable to Owner. d. By executing this Agreement Contractor agrees to abide by and be bound by the indemnification provisions herein. 8. DISPUTE RESOLUTION AND GOVERNING LAW a. Any dispute with respect to any provision of, or the performance or non-performance of, this Agreement shall be subject to the Dispute Resolution Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). b. The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement or the Contract shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. c. Notice of any claim by Owner or Contractor must be initiated by written notice to the other Party within thirty (30) days of the occurrence of the event giving rise to the claim or within thirty (30) days of the discovery of the event or condition giving rise to the claim, whichever is later. i. Should any claim be made, regardless of whether such claim is made by Owner or Contractor, Contractor shall continue to faithfully and diligently perform the Work in such a manner as to meet all scheduled timelines. Any failure to faithfully and diligently perform the Work may be deemed, by the Owner, a breach of the Contract. ii. If a claim is made such claim shall be made to the initial decision maker, if applicable, who may request more supporting data, reject the claim in whole or in part, approve the claim in whole or in part or advise the parties the claim is unable to be resolved. iii. If a claim is made by the Owner the Owner may, but is not obligated to, notify the surety. 9. NON–APPROPRIATION a. Contractor acknowledges that Owner is a governmental entity, and the validity of this Agreement is based upon the availability of public funding under the authority of its statutory mandate. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 6 b. In the event that public funds are unavailable or not appropriated for the performance of Owner’s obligations under this Agreement, then this Agreement shall automatically expire without penalty to Owner immediately upon written notice to Contractor of the unavailability or non-appropriation of public funds. It is expressly agreed that Owner shall not activate this non-appropriation provision for its convenience or to circumvent the requirements of this Agreement. c. In the event of a change in the Owner’s statutory authority, mandate or mandated functions, by state or federal legislative or regulatory action, which adversely affects Owner’s authority to continue its obligations under this Agreement, then this Agreement shall automatically terminate without penalty to Owner upon written notice to Contractor of such limitation or change in Owner’s legal authority. 10. NOTICES Any notice required by this Agreement shall be in writing and delivered by certified or registered mail, return receipt requested to the following: Owner: Contractor: Orange County Vaughan Electric Co., Inc. Attn: A. Barnes Attn: Samual D. Vaughan IV P.O. Box 8181 3007 Holloway Street Hillsborough, NC 27278 Durham, NC 27703 11. MISCELLANEOUS a. Duties and Obligations imposed by the Contract Documents shall be in addition to any Duties and Obligations imposed by state, federal or local law, rules, regulations and ordinances. b. No act or failure to act by the Owner or Contractor shall constitute a waiver of any right or duty granted them under the Contract Documents, nor shall any act or failure to act constitute any approval except as specifically agreed in writing. c. The Work shall be tested and inspected as required by the Contract Documents and as required by law. Unless prohibited by law the costs of all such tests and inspections related to state and federal codes such as ADA, Administrative, Electrical, Plumbing, Mechanical and Building Codes shall be borne by the Contractor. The costs for material and structural testing shall be conducted by an independent third party at the expense of the Owner. Delays related to any of the aforementioned tests and inspections shall not be grounds for delaying the completion of the work. If any such tests and inspections reveal deficiencies in the Work such that the Work does not comply with terms or requirements of the Contract Documents and the requirements of any code or law the Contractor is solely responsible for the cost of bringing such deficiencies into compliance with the terms of the Contract Documents and any code or law. d. Should the Architect, if an architect is retained for the project involving the Work, or Owner reject any portion of the Work for failing to comply with the Contract Documents Contractor shall immediately, at Contractor’s expense, correct the Work. Any such rejection may be made before or after substantial completion. If applicable, any additional Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 7 expense borne by the Architect under this section shall be paid at Contractor’s expense. e. The Contractor shall not assign any portion of this Agreement nor subcontract the Work in its entirety without the prior written consent of the Owner. f. By executing this Agreement Contractor affirms that Contractor and any subcontractors of Contractor are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. g. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. h. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. i. The County has designated (Angel Barnes) to act as the County's representative with respect to the Work and shall have the authority to render decisions within guidelines established by the County Manager or the County Board of Commissioners and shall be available during working hours as often as may be reasonably required to render decisions and to furnish information. j. Contractor shall at all times remain in compliance with all applicable local, state, and federal laws, rules, and regulations including but not limited to all state and federal non- discrimination laws, policies, rules, and regulations and the Orange County Non- Discrimination Policy and Orange County Living Wage Policy (each Orange County policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Any violation of the Orange County Non-Discrimination Policy is a breach of this Agreement and County may immediately terminate this Agreement without further obligation on the part of the County. This paragraph is not intended to limit and does not limit the definition of breach to discrimination. k. This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. l. In the event of a breach by Contractor Owner has sole authority to determine the reasonableness of Contractor’s actions to remedy such breach or complete the performance of its obligations. m. Upon request of the Owner, the Contractor shall submit to County all relevant documentation, including but not limited to, job cost records, to support its claims for final compensation and if such request is made final compensation shall not be due until all relevant documentation is received, reviewed, and approved by Owner. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 8 n. There are no third-party beneficiaries of this Agreement and nothing in this Agreement, express or implied, is intended to confer on any person other than the parties hereto (and their respective successors, heirs and permitted assigns), any rights, remedies, or obligations. 12. CONSEQUENTIAL AND LIQUIDATED DAMAGES a. Owner and Contractor mutually waive any claim against each other for consequential damages. Consequential Damages include: i. Damages incurred by Owner for loss of use, income, financing, or business. ii. Damages incurred by Contractor for office expenses, including personnel, loss of financing, profit, income, business, damage to reputation, or any other non-direct damages. b. Liquidated damages shall be in accord with the Contract Documents. If the Contract Documents do not otherwise address liquidated damages, such damages shall be in the amount of five hundred dollars ($500.00) per day. 13. TERMINATION OR SUSPENSION a. The Owner may, without cause, order the Contractor to terminate, suspend, delay or interrupt the Work in whole or in part for such period of time as the Owner may determine. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is not due to or as a result of any fault on the part of the Contractor or any subcontractor, the Contractor may recover a per diem amount of five hundred dollars ($500.00) per day with a not-to-exceed limit of ten thousand dollars ($10,000.00). ii. In the event of termination by the Owner under this Agreement, the Contractor shall be entitled to receive its reasonable and documented direct costs incurred prior to the date Owner mails the notice of termination, including the cost of materials purchased for the Work, but only if such purchases cannot be canceled, or materials returned, or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the work in a safe and efficient manner. iii. If Owner elects to suspend or terminate the contract pursuant to subparagraphs 13.a.i. or 13 a.ii. the sole remedy available to the Contractor are those listed in said subparagraphs and Contractor is not entitled to any right to further claims for any amount owed or disputed or for payment of damages alleged to have been sustained as a result of Owner’s order to delay, suspend, or interrupt the Work. b. The Owner may, with cause, order the Contractor to suspend, delay or interrupt the Work in whole or in part for such period of time as the cause remains. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is due to or as a result of any fault on the part of the Contractor or any subcontractor, the Owner may reduce payment at a per diem amount of five Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 9 hundred dollars ($500.00) per day for the full duration of the delay, suspension, or interruption. c. Contractor may terminate the Contract if, at the Owner’s written direction, the Work is stopped for thirty (30) consecutive days through no act or fault of the Contractor, their agents or employees, or a subcontractor or their agents or employees or any other person performing work pursuant to the Contract Documents. Contractor may terminate the Contract if a Court or other Public authority having jurisdiction enters a lawful order that requires all work to be stopped and such stoppage lasts for thirty (30) consecutive days. d. Either party may terminate this Agreement upon notice to the other party that obligations pursuant to this Agreement are made impossible due to declarations of emergency by Orange County or by North Carolina due to events directly impacting Orange County. Both parties shall remain responsible for all payment and performance due up to the receipt of such notice, but shall have no further obligation or responsibility beyond that date provided the terminating party has taken all reasonable steps to complete the performance of its obligations. 14. ENTIRE AGREEMENT All of the documents listed, referenced or described in this Agreement, the written Notice-to- Proceed, together with Modifications made or issued in accordance herewith are the Contract Documents, and the work, labor, materials and completed construction required by the Contract Documents and all parts thereof is the Work. The Contract Documents constitute the entire agreement between Owner and Contractor. This Agreement may be amended only by written instrument signed by both parties. Modifications may be evidenced by facsimile signatures. If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. IN WITNESS WHEREOF, the Parties hereto have executed this Agreement as of the day and date first above written wholly or in a number of counterparts each of which shall, without proof or accounting for other counterparts, be deemed an original contract. ORANGE COUNTY CONTRACTOR ____________________________________ ________________________________________ Signature Signature County Manager ________________________________________ Printed Name and Title Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Samual D Vaughan IV Vice President 6/10/20266/24/2026 Revised 01/24 10 ORANGE COUNTY—INTERNAL USE ONLY ______________________________________________________________________________ Finance Information Vendor Name: Vaughan Electric Co., Inc. Vendor Contact Person: Samuel D. Vaughan IV (sdvaughaniv@veco-nc.com) Phone: 919.596.2967 Address: 3007 Holloway Street City Durham State: NC Zip: 27703 Department: AMS Amount: $44,500.00 Purpose: ES - Replace Exterior Lighting, Passmore Add Exterior Lighting Budget Code(s): 61370035-800000- 11005 Vendor # 56915 Vendor Status with NCSOS: Current-Active Vendor is a BOCC consultant: Yes No Contract Details Contract Type: New Amendment (Original Contract: ) (Most Recent Amendment ) Effective Date 05/18/2026 End Date 12/30/2026 Notice Date (Notice Purpose ) Award Approved by Board (Agenda Date: ); Made or Administered by AMS Signature Authority - BOCC Express Delegation (Agenda Date: ) - Policy 9.4: Under $5,000; Service Under $90,000; Construction Under $250,000 - Budget Policy Section XV (Capital Improvement Project: Electrical 11005) Bidding Informal Bidding ($30k-$90k); Formal RFP ($90k+); Other (<$30k); Exception(#RFP 367-OC5474) Department Affirmation This agreement is approved as to technical form and content and I as Department Director affirmatively state work on this project has not been initiated prior to execution of the agreement ; OR This agreement is approved as to technical form and content . Services related to this agreement have already begun or been completed. Description of the nature of the emergency condition that was addressed: Department Director’s Signature ________________________________________ Date: ________ Information Technologies This agreement has been reviewed and is approved as to information technology content and specifications: Office of the Chief Information Officer___________________________________ Date: ________ Inapplicable because no hardware/software purchases or related services Risk Management This agreement is approved for sufficiency of insurance standards, specifications, and requirements: Office of the Risk Management Officer___________________________________ Date: _________ Financial Services This instrument has been pre-audited in the manner required by the Local Government Budget and Fiscal Control Act: Office of the Chief Financial Officer ____________________________________ Date: _________ Legal Services This agreement is approved as to legal form and sufficiency: Office of the County Attorney __________________________________________Date: ________ Clerk to the Board All Docusign contracts must be copied to the Clerk upon completion: occlerkdocs@orangecountync.gov The following signature block is for hard copies only and is not required for Docusign contracts: Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 6/11/2026 6/23/2026 6/23/2026 6/24/2026 Revised 01/24 11 Received for record retention: Office of the Clerk to the Board __________________________________________Date:_________ Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Bid Page #1 Rev 2024-02 COUNTY OF ORANGE FINANCE AND ADMINISTRATIVE SERVICES – PURCHASING PO BOX 8181 HILLSBOROUGH, NORTH CAROLINA 27278 ORANGE COUNTY BID NO. 367-OC5474 February 25, 2026 ATTENTION: INTERESTED VENDORS Orange County requests your competitive quotation to furnish the item(s) listed below for Orange County Exterior Lighting Upgrades, Hillsborough, NC. A non-mandatory site visit is scheduled for Thursday, March 12, 2026, at 10:00 am at the Jerry M. Passmore Center located at 103 Meadowlands Drive, Hillsborough, NC 27278. This is the only scheduled time for contractors to view the site. By submission of a bid, the contractor acknowledges that/they fully understand the extent of the project. Please transmit this quotation via email to the Orange County Finance Manager-Purchasing at finance- purchasing@orangecountync.gov, no later than March 31, 2024, at 2:00 PM Item # Commodities/Goods or Services 1 The Work consists of providing all labor and materials to upgrade the exterior lighting at the Jerry M. Passmore Center located at 103 Meadowlands Drive, per the drawings: G01.01, E0.00, E1.01, E1.02, E1.03, and specifications dated 06/19/2025 SUBMIT PRICING ON ATTACHMENT A 2 This Work consists of providing all labor and materials to upgrade the exterior lighting at the Emergency Services Center located at 510 Meadowlands Drive, per the drawings: E-1 and specifications dated 06/09/2025 SUBMIT PRICING ON ATTACHMENT A Will any people working on this job make less than the current adopted Orange County Living Wage Yes _______ No_______ If yes, the lowest hourly wage to be paid to any employee shall be: $_______/ Hour **SEE ATTACHED INSTRUCTIONS TO BIDDERS** License _____________ (if applicable) FIRM NAME ________________________________________ BY ______________________________________________ (Proposal must be signed in writing) ADDRESS __________________________ FAX: _____________________________________________ __________________________ TELEPHONE: ______________________________________ EMAIL: ___________________________________________ 14-U Vaughan Electric Co. Inc sdvaughaniv@veco-nc.com 3007 Holloway Street Durham, NC 27703 919-596-1327 919-596-2967 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Bid Page #2 Rev 2024-02 COUNTY OF ORANGE FINANCE AND ADMINISTRATIVE SERVICES – PURCHASING PO BOX 8181 131 WEST MARGERET LANE HILLSBOROUGH, NORTH CAROLINA 27278 Instructions to Bidders 1. All bids and proposals shall be for furnishing apparatus, supplies, materials, equipment , and/or work and services in accordance with the applicable plans and specifications prescribed by Orange County. Plans and/or specifications may be obtained at Orange County’s website https://www.orangecountync.gov/Bids.aspx 2. Orange County reserves the right to: o award to the lowest responsible bidder that is responsive, o to reject any or all bids, o And to waive minor informalities. 3. The successful bidder shall comply fully with the requirements of General Statutes, Section 143-129 and 143-131, as amended. This is an informal range; therefore, there will not be a formal opening. Results will be made available after the award. 4. In the event of default by any contractor or vendor Orange County may procure from other sources whatever service or item is being bid and holds the contractor responsible for any excess cost occasioned thereby. 5. Payment by electronic funds transfer is due thirty days after completion and inspection unless otherwise specifically provided; subject to any discounts allowed. 6. North Carolina sales and use tax shall be included in the bid amount. 7. Bids shall be submitted via email to finance-purchasing@orangecountync.gov 8. Proposals received after the opening date and time shall not be considered. 9. Bids must be signed and submitted on the attached form of the proposal. 10. The successful contractor shall be responsible for obtaining all permits and inspections. 11. The successful contractor shall be required to agree to and sign the Orange County Service Agreement (copy attached). Among the items included in that agreement are the County’s Insurance requirements and sales tax. 12. All contractors are hereby notified that they must have proper licenses as required under the state laws governing their respective trades. General contractors are notified that Chapter 87, Article 1, General Statutes of North Carolina, will be observed in receiving and awarding general contracts. General contractors submitting bids on this project must have license classification for “Unlimited Building” or “Unclassified,” required by the NC General Contractors Licensing Board under G.S. 87-1. 13. Please direct questions concerning this bid document to Jovana Amaro, Finance Manager-Purchasing, (919) 245- 2651, or via email at finance-purchasing@orangecountync.gov. Please direct any questions about the scope, site visit, details of the work, or the proposal to Angel Barnes, Orange County Capital Projects Manager, Orange County Asset Management Services, 919-245-2628, email: abarnes@orangecountync.gov. 14. A non-mandatory site visit is scheduled for Thursday, March 12, 2026, at 10:00 am at the Jerry M. Passmore Center located at 103 Meadowlands Drive, Hillsborough, NC 27278. This is the only scheduled time for contractors to view the site. By submission of a bid, the contractor acknowledges that/they fully understand the extent of the project. 15. Business Registration: Corporations, LLCs, LLPs, and foreign entities conducting business in North Carolina must maintain an active registration with the NC Secretary of State in order to legally transact business with the County. 16. Minority Business Participation The following forms are required to be completed and included with your bid: - Identification of HUB Certified/ Minority Business Participation Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Bid Page #3 Rev 2024-02 - Affidavit A: Listing of Good Faith Efforts or - Affidavit B: Intent to Perform Contract with Own Workforce (If you intend to complete this project with your own workforce) *** If the above documents are not provided, your bid will be deemed non-responsive*** Please note: Affidavit C or Affidavit D will be required to be submitted by the apparent lowest responsive, responsible bidder. - Affidavit C: Portion of the Work to be Performed by HUB Certified/Minority Bus inesses (if the portion of the work to be executed by minority businesses is equal to or greater than 10% of the bidder’s total contract price) - Affidavit D: Good Faith Efforts (if the 10% participation goal is not achieved, the bidder must provide supporting documentation of their good faith efforts) The following forms must be returned with your bid package. o Contractor’s Completed and Signed Bid Forms o Living Wage Contractor Policy o E-Verify Affidavit o Orange County Nondiscrimination Certification o Supplemental Vendor Information: Historically Underutilized Businesses o Minority Business Participation Forms – Affidavit A or B The following documents are included in this bid package for yo ur reference and use. o Construction Contract Sample o Dispute Resolution Rules and Procedures o Minimum Insurance Requirements o Sales Tax Forms o Drawings and Specifications Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Bid Page #4 Rev 2024-02 Attachment A RFP – 367-OC5474 Bid Proposal Form: 1. Jerry M. Passmore Exterior Lighting The contractor agrees to furnish all materials, labor, and any other supplies or equipment necessary to complete the above work, for the sum of: $____________________________ Labor $____________________________ Materials $____________________________ Total BID for Jerry M. Passmore Exterior Lighting 2. Emergency Services Exterior Lighting Upgrade The contractor agrees to furnish all materials, labor, and any other supplies or equipment necessary to complete the above work, for the sum of: $____________________________ Labor $____________________________ Materials $____________________________ Total BID for Em ergency Services Exterior Lighting Upgrade • All work must be completed within 220 days of the project start date (approx. April 1, 2026) (anticipated completion date November 7, 2026). • Contractor is willing to participate in the County’s “DocuSign” digital contracting process and enter into a standard contract with the County. • No proposal may be withdrawn after the scheduled closing time and date for the receipt of Bids for a period of (60) sixty days. ________________________________________________________ (Name of firm or corporation making bid) By: _____________________________________________________ Signature Name: ___________________________________________________ Print or type Title _____________________________________________________ Vaughan Electric Co. Inc Samuel D. Vaughan IV Vice President $7,500.00 $4,500.00 $12,000.00 $22,500.00 $10,500.00 $32,500.00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Bid Page #5 Rev 2024-02 (Owner/Partner/Pres./V.Pres) Address __________________________________________________ __________________________________________________________ License No._________________________________________________ Federal I.D. No. ______________________________________________ Email Address: _______________________________________________ Addendum(s) received and used in computing bid: (Check or date beside each addendum your firm is using for computing your bid) Addendum No. 1 _______ Addendum No. 3 _______ Addendum No. 5 _______ Addendum No. 7 _______ Addendum No. 2 _______ Addendum No. 4 _______ Addendum No. 6 _______ Addendum No. 8 _______ Checklist for Items to be returned with the bid. All items listed below must be returned with your bid package.  Contractor’s Completed and Signed Form of Proposal  Living Wage Contractor Policy  E-Verify Affidavit  Orange County Nondiscrimination Certification  Supplemental Vendor Information: Historically Underutilized Businesses  MB Participation Forms 3007 Holloway Street, Durham, NC 27703 14-U sdvaughaniv@veco-nc.com 56-1296585 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Vaughan Electric Co. Inc Chad Vaughan 3 / 31 / 2026 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Chad Vaughan , Vice President Vaughan Electric Co. Inc Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Supplemental Vendor Information: HISTORICALLY UNDERUTILIZED BUSINESSES Vendor Name: ____________________________________________________ Date: _________ Per G.S. 143-128.4, Historically Underutilized Businesses (HUBs) consist of minority, women and disabled business firms that are at least fifty-one percent (51%) owned and operated by an individual(s) who are members of the following groups: Black, Hispanic, Asian American, American Indian, Female, Disabled, Disadvantaged. The Vendor shall respond to question No 1 and No 2 below. 1)Is Vendor a Historically Underutilized Business? Yes No If yes, please select from the following: Ethnicity: Gender Disabled Black Male Yes Hispanic Female No Asian American American Indian 2)Is Vendor Certified with North Carolina as a Historically Underutilized Business? Yes No If so, state HUB classification: _______________________________________________________ Any questions concerning NC HUB certification, contact the North Carolina Office of Historically Underutilized Businesses at (919) 807-2330. Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Diversified Supply Inc,3/31/26 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Vaughan Electric Co. Inc Diversified Supply Inc, 1(800) 865-1551 Supplier B Y 14,000.00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 3007 Holloway Street, Durham, NC 27703 (919) 596-1327 PAYMENT OPTION AND QUICK PAY DISCOUNT AGREEMENT Vaughan Electric Co. Inc (VECO) offers different payment methods to best meet the needs of our subcontractors, including the following: Direct Deposit (EFT) – With this payment method, VECO will process an automated deposit directly into your bank account after receiving all required documents needed for settlement. Direct deposit payment are processed on a daily basis, with payments initiated on the day payments are due based upon the Payment Option Selected in the attached Appendix “A”. Payments will be credited to your account one business day after they are processed by VECO. There is no fee associated with this payment method. We will e-mail (preferred) or fax supporting remittance information each time a payment is made to the address provided below. Remittance E-Mail: Remittance Fax #: For us to set up this payment method, we must receive a completed Direct Deposit (EFT) Enrollment Form and Agreement (Appendix “B” attached). We will also need a copy of a VOIDED check with the account and bank routing numbers for the account you wish to use for these deposits. Attach your VOIDED check in the space provided below as well as the address you wish the remittance information to go to. Check Payments – If you elect to be paid by check, payments will be processed on the Friday morning that payments were due and mailed out that afternoon. Remittance information will be mailed with the check detailing the loads that were paid with that check. Quick Pay – Reliant offers two different Quick Pay options for our Carriers, with a Payment Discount applied based upon the Payment Option Selected (see Appendix “A” attached for terms and agreement). If you elect to be set up for one of the Quick Pay Options, you will also be required to complete the Direct Deposit (EFT) Enrollment Form and Agreement (Appendix “B”, attached), in order to be set up in our system to receive Direct Deposit (EFT) payments. Please complete all applicable forms and e-mail to svaughanjr@veco-nc.com, fax to (919) 596-2967, or mail to the address at the bottom of this form. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 3007 Holloway Street, Durham, NC 27703 (919) 596-1327 APPENDIX “A” QUICK PAY DISCOUNT AGREEMENT By executing this Appendix “A”, Subcontractor is requesting that VECO make early payment of application of payment. Upon final payment of application, verification of completion of the work, and after providing all requested or necessary documents to confirm completion of subcontractor’s responsibilities without loss or damage, VECO agrees to pay to subcontractor the amount of the agreed rate, as confirmed by VECO. Upon receiving the necessary documents (and after allowing for a reasonable processing time), VECO will make payment on the following schedule, by mailing a check to Subcontractor or by ACH Transfer. Payment Option Payment Method Calendar Days Payment Discount Quick Pay Direct Deposit (EFT) 1 2.50% 10-Day Quick Pay Direct Deposit (EFT) 10 2.00% 20-Day Terms Direct Deposit (EFT) or Check 20 0.00% In no event shall the payment of any agreed rate on an expedited basis be construed as a waiver or release of Subcontractor’s obligations under the Agreement or as an acceptance of Subcontractor’s performance under the Agreement. Carrier understands and agrees that it may take Reliant up to ten (10) business days from the execution of this Quick Pay Discount Agreement to begin implementing the initial Quick Pay Payment Program. Payment Option Selected: (From the list above) (Carrier Name) By: (sign by an officer of the company) Title: (E.g. “Owner”, “President”, “Vice President”, etc.) Date: Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 3007 Holloway Street, Durham, NC 27703 (919) 596-1327 VOIDED CHECK APPENDIX “B” DIRECT DEPOSIT (EFT) ENROLLMENT FORM AND AGREEMENT **Please Print or Type All Information** Company / Payee: Name: Address: City: State: Zip Code: Contact Person: Phone: E-Mail Address: Fax: Financial Institution Name: Address: City: State: Zip Code: Contact Name: Phone: Routing Number: (9 digits) Account Number: Account Type: Checking: Savings: I hereby Vaughan Electric Co. Inc. (“VECO”) to automatically deposit payments to the account listed above under the terms and conditions of this Direct Deposit (EFT) Enrollment Form and Agreement. I certify that I am authorized to enter into this agreement on behalf of the account holder. I verify that the information provided on this form is correct and that VECO may rely on it. Established payment terms are not affected, and payments will be deposited into the account designated above. Any chang es to this agreement must be in writing, please allow up to ten (10) business days to execute your instructions. Authorized Signature: Date: Name: Title: Date: Approved By: OFFICE USE ONLY Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 06/09/2025Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ORANGE COUNTY, NORTH CAROLINA EMERGENCY SERVICES - LIGHTING HILLSBOROUGH, NORTH CAROLINA PDC PROJECT #24029 MARCH 2025 Prepared by Progressive Design Collaborative, Ltd. 3101 Poplarwood Court, Suite 320, Raleigh, North Carolina 27604 Phone (919) 790-9989 – Fax (919) 790-9367 License #: C-0183 JUNE 2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 THIS PAGE INTENTIONALLY LEFT BLANK Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services - Lighting PDC #24029 TABLE OF CONTENTS 1 TABLE OF CONTENTS DIVISION 00 - PROCUREMENT AND CONTRACTING REQUIREMENTS FORM OF PROPOSAL CONSTRUCTION CONTRACT TEMPLATE DISPUTE RESOLUTION RULES & PROCEDURES LIVING WAGE CONTRACTOR POLICY E-VERIFY AFFIDAVIT OC NONDISCRIMINATION CERTIFICATION SUPPLEMENTAL VENDOR INFORMATION MB PARTICIPATION FORMS MINORITY BUSINESS PARTICIPATION REQUIREMENTS MINIMUM INSURANCE REQUIREMENTS DIVISION 01 - GENERAL REQUIREMENTS 01 20 00 PRICE AND PAYMENT PROCEDURES 2 01 21 00 ALLOWANCES 1 01 25 00 SUBSTITUTION PROCEDURES 1 01 30 00 ADMINISTRATIVE REQUIREMENTS 4 01 32 16 CONSTRUCTION PROGRESS SCHEDULE 2 01 40 00 QUALITY REQUIREMENTS 1 01 60 00 PRODUCT REQUIREMENTS 2 01 70 00 EXECUTION AND CLOSEOUT REQUIREMENTS 6 01 78 00 CLOSEOUT SUBMITTALS 3 DIVISION 26 - ELECTRICAL 26 01 00 ELECTRICAL GENERAL PROVISIONS 4 26 05 05 ELECTRICAL DEMOLITION 2 26 05 19 POWER CONDUCTORS AND CABLES 5 26 05 33.13 CONDUIT FOR ELECTRICAL SYSTEMS 7 26 51 00 INTERIOR AND EXTERIOR LIGHTING 4 6/9/25 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 1 [Departmental Use Only] TITLE TEMPLATE FOR REFERENCE FY NORTH CAROLINA CONSTRUCTION AGREEMENT UNDER $250,000.00 ORANGE COUNTY THIS CONSTRUCTION AGREEMENT (hereinafter called “Agreement”), made as of the day of , 20 , by and between , (hereinafter called the “Contractor”), and Orange County, a political subdivision of the State of North Carolina, (hereinafter called the “County,” “Orange County,” or “Owner”). W I T N E S S E T H: That the Contractor and the Owner, for the consideration herein named, agree as follows: 1. CONTRACT DOCUMENTS; PRIORITY The Contract Documents consist of this Agreement, the Request for Proposals, Proposal, Construction Drawings, and Written Specifications. The Contract Documents form the Contract. In the event of any inconsistency between or among the Contract Documents the Contract Documents shall be interpreted in the following order of priority: a. This Agreement. b. Designer Approved Bulletins and Field Orders. c. Request for Proposals and addenda thereto. d. Proposal. 2. SCOPE OF WORK The Contractor shall furnish and deliver all of the materials, and perform all of the work required by this Agreement within the time period stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner and in accordance with the following enumerated documents, which are made a part hereof as if fully contained herein: a. Construction Drawings prepared by (Sheet dated ) b. Written specifications prepared by the project engineer. c. proposal dated , 20 which fully describes the work to be performed. Such work will hereafter be called the “Work”. d. Related documents listed under Section 1 above. 3. TERM AND SCHEDULING a. The Contractor agrees to commence work pursuant to the written Notice to Proceed. b. The Contractor agrees to complete substantially all Work by , 20 . Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 2 c. Time is of the essence with respect to all dates specified in the Contract Documents as Completion Dates. d. The Contractor shall perform the Work in the time, manner, and form required by the Contract Documents and as stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner. e. It is expressly understood that the Owner will employ other contractors to perform work as a part of the Project whose work will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate its activities with such other contractors, particularly with respect to access to work areas, storage of materials and other common facilities. f. Should the Owner determine that the Contractor is behind schedule Owner may require, at no additional cost to the Owner, the Contractor to expedite and accelerate its efforts, including providing additional resources and working overtime, as necessary, to perform the Work in accordance with the approved project schedule. 4. STANDARD OF CARE a. The Contractor shall exercise reasonable care and diligence in performing the Work in accordance with the highest generally accepted standards of this type of Contractor practice throughout the United States and in accordance with applicable federal, state and local laws and regulations applicable to the performance of these services. Contractor is solely responsible for the professional quality, accuracy and timely completion and submission of all work. b. The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance or configuration. c. Contractor shall be responsible for all errors or omissions caused by its employees, agents, contractors, or assigns in the performance of the Agreement. Contractor shall correct any and all errors, omissions, discrepancies, ambiguities, mistakes or conflicts at no additional cost to the Owner. d. Contractor is an independent contractor of Owner. Any and all employees of the Contractor engaged by the Contractor in the performance of any work or services required of the Contractor under this Agreement, shall be considered employees or agents of the Contractor only and not of the Owner, and any and all claims that may or might arise under any workers compensation or other law or contract on behalf of said employees while so engaged shall be the sole obligation and responsibility of the Contractor. e. If activities related to the performance of this Agreement require specific licenses, certifications, or related credentials Contractor represents that it or its employees, agents and subcontractors engaged in such activities possess such licenses, certifications, or credentials and that such licenses certifications, or credentials are current, active, and not in a state of suspension or revocation. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 3 f. The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor and Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, or control, and all such property while it is in transit. g. The Contractor is solely responsible for obtaining all permits necessary to complete the Work in compliance with all local, state, and federal laws. 5. PAYMENT & TAXES a. The Owner hereby agrees to pay to the Contractor for the faithful performance of this Agreement and the Contractor hereby agrees to perform all of the Work for a sum not-to- exceed Dollars ($ ). Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Owner’s Representative, generally the architect if an architect is retained on the Work, a Request for Payment for work done during the previous calendar month. i. The Request for Payment shall be in form of a standardized invoice or AIA Document G702-703 appropriately addressed to Owner’s Representative at and shall show substantially the value of work done during the previous calendar month. ii. The amount due for payment shall be ninety-five percent (95%) of the value of work completed since the last Request for Payment and this amount shall be paid by the Owner on or before the last business day of the month. Owner shall retain five percent (5%). 1. Upon Owner’s Representative’s certification that ninety percent (90%) of the Work has been satisfactorily completed retainage may be discontinued. Retainage may be discontinued, at Owner’s Discretion, so long as work continues to be completed satisfactorily and on schedule. iii. Final payment shall not be due to the Contractor until thirty (30) days after one hundred percent (100%) of the Work, including punch list work, has been satisfactorily (as determined by the County) completed and an appropriate affidavit as required in Section 7(c) below has been received by Owner. b. Should Owner reasonably determine that Contractor has failed to perform the Work related to a Request for Payment, Owner, at its discretion may provide the Contractor ten (10) days to cure the breach. Owner may withhold the accompanying payment without penalty until such time as Contractor cures the breach. i. Should Contractor or its representatives fail to cure the breach within ten (10) days, or fail to reasonably agree to such modified schedule, Owner may immediately terminate this Agreement in writing, without penalty or incurring further obligation to Contractor. ii. This section shall not be interpreted to limit the definition of breach to the failure to perform the Work related to a Request for Payment. c. The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. It shall be the Contractor's responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of its subcontractors. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 4 6. INSURANCE AND BONDS a. Minimum requirements – Contractor shall obtain, at its sole expense, Commercial General Liability Insurance, Automobile Insurance, Workers’ Compensation Insurance, and any additional insurance as may be required by Owner’s Risk Manager as such insurance requirements are described in the Orange County Risk Transfer Policy and Orange County Minimum Insurance Coverage Requirements (each document is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). If Owner’s Risk Manager determines additional insurance coverage is required such additional insurance shall be designated here (if no additional insurance required mark N/A as being not applicable). Contractor shall not commence construction work until such insurance is in effect and certification thereof has been received by the Owner's Risk Manager. b. Performance Bonds – Contractor shall furnish bonds covering the faithful performance of the Contract and payment of all obligations arising under any of the Contract Documents or related in any way to the Work. Contractor shall immediately furnish a copy of such bonds to any requesting person who appears to be a potential beneficiary of bonds covering payment obligations arising under any of the Contract Documents. This subsection 6(b) applies only to Contracts of fifty thousand dollars ($50,000.00) or more where the total cost for the project is three hundred thousand dollars ($300,000.00) or more. 7. INDEMNITY a. To the extent authorized by North Carolina law the Contractor shall indemnify, without limitation, and hold harmless to the maximum extent permitted by law the Owner and its agents and employees from and against any and all claims, damages, losses and expenses, including attorney's fees, arising out of or resulting from the performance or nonperformance of the Work, provided that any such claim, damages, loss or expense (A) is attributable to bodily injury, sickness, disease or death or injury to, or destruction of, property, including the loss of use resulting therefrom; and (B) is caused in whole or in part by any breach of any provision of the Agreement or by any negligent or wrongful act or omission of the Contractor, any Subcontractor, or supplier of the Contractor, anyone directly or indirectly employed by any of them or anyone for whose acts any of them may be liable. The indemnification obligation under this paragraph shall not be limited in any way by any limitation of the amount or type of damages, compensation or benefits payable by or for the Contractor or any subcontractor under workers' compensation acts, disability benefits acts or other employee benefit acts. It is the intent of this section that the Contractor shall indemnify the County to the maximum extent allowed by law. b. The Contractor shall indemnify and hold harmless Owner from any lien of whatever type through the purchase of appropriate bonds and insurance as designated in Section 6 above. In the event any such lien is filed against Owner’s property Contractor shall, through such bonds and insurance or at Contractors expense, defend Owner against all such claims of lien. c. Upon completion of the Work the Contractor shall execute an affidavit stating there are no unpaid debts for any work that has been done or materials that have been furnished to the Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 5 project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such debts and liens. Such indemnification shall be in a form and substance acceptable to Owner. d. By executing this Agreement Contractor agrees to abide by and be bound by the indemnification provisions herein. 8. DISPUTE RESOLUTION AND GOVERNING LAW a. Any dispute with respect to any provision of, or the performance or non-performance of, this Agreement shall be subject to the Dispute Resolution Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). b. The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement or the Contract shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. c. Notice of any claim by Owner or Contractor must be initiated by written notice to the other Party within thirty (30) days of the occurrence of the event giving rise to the claim or within thirty (30) days of the discovery of the event or condition giving rise to the claim, whichever is later. i. Should any claim be made, regardless of whether such claim is made by Owner or Contractor, Contractor shall continue to faithfully and diligently perform the Work in such a manner as to meet all scheduled timelines. Any failure to faithfully and diligently perform the Work may be deemed, by the Owner, a breach of the Contract. ii. If a claim is made such claim shall be made to the initial decision maker, if applicable, who may request more supporting data, reject the claim in whole or in part, approve the claim in whole or in part or advise the parties the claim is unable to be resolved. iii. If a claim is made by the Owner the Owner may, but is not obligated to, notify the surety. 9. NON–APPROPRIATION a. Contractor acknowledges that Owner is a governmental entity, and the validity of this Agreement is based upon the availability of public funding under the authority of its statutory mandate. b. In the event that public funds are unavailable or not appropriated for the performance of Owner’s obligations under this Agreement, then this Agreement shall automatically expire without penalty to Owner immediately upon written notice to Contractor of the Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 6 unavailability or non-appropriation of public funds. It is expressly agreed that Owner shall not activate this non-appropriation provision for its convenience or to circumvent the requirements of this Agreement. c. In the event of a change in the Owner’s statutory authority, mandate or mandated functions, by state or federal legislative or regulatory action, which adversely affects Owner’s authority to continue its obligations under this Agreement, then this Agreement shall automatically terminate without penalty to Owner upon written notice to Contractor of such limitation or change in Owner’s legal authority. 10. NOTICES Any notice required by this Agreement shall be in writing and delivered by certified or registered mail, return receipt requested to the following: Owner: Contractor: Orange County Attn: P.O. Box 8181 Hillsborough, NC 27278 11. MISCELLANEOUS a. Duties and Obligations imposed by the Contract Documents shall be in addition to any Duties and Obligations imposed by state, federal or local law, rules, regulations and ordinances. b. No act or failure to act by the Owner or Contractor shall constitute a waiver of any right or duty granted them under the Contract Documents, nor shall any act or failure to act constitute any approval except as specifically agreed in writing. c. The Work shall be tested and inspected as required by the Contract Documents and as required by law. Unless prohibited by law the costs of all such tests and inspections related to state and federal codes such as ADA, Administrative, Electrical, Plumbing, Mechanical and Building Codes shall be borne by the Contractor. The costs for material and structural testing shall be conducted by an independent third party at the expense of the Owner. Delays related to any of the aforementioned tests and inspections shall not be grounds for delaying the completion of the work. If any such tests and inspections reveal deficiencies in the Work such that the Work does not comply with terms or requirements of the Contract Documents and the requirements of any code or law the Contractor is solely responsible for the cost of bringing such deficiencies into compliance with the terms of the Contract Documents and any code or law. d. Should the Architect, if an architect is retained for the project involving the Work, or Owner reject any portion of the Work for failing to comply with the Contract Documents Contractor shall immediately, at Contractor’s expense, correct the Work. Any such rejection may be made before or after substantial completion. If applicable, any additional expense borne by the Architect under this section shall be paid at Contractor’s expense. e. The Contractor shall not assign any portion of this Agreement nor subcontract the Work in Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 7 its entirety without the prior written consent of the Owner. f. By executing this Agreement Contractor affirms that Contractor and any subcontractors of Contractor are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. g. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. h. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. i. The County has designated ( ) to act as the County's representative with respect to the Work and shall have the authority to render decisions within guidelines established by the County Manager or the County Board of Commissioners and shall be available during working hours as often as may be reasonably required to render decisions and to furnish information. j. Contractor shall at all times remain in compliance with all applicable local, state, and federal laws, rules, and regulations including but not limited to all state and federal non- discrimination laws, policies, rules, and regulations and the Orange County Non- Discrimination Policy and Orange County Living Wage Policy (each Orange County policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Any violation of the Orange County Non-Discrimination Policy is a breach of this Agreement and County may immediately terminate this Agreement without further obligation on the part of the County. This paragraph is not intended to limit and does not limit the definition of breach to discrimination. k. This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. l. In the event of a breach by Contractor Owner has sole authority to determine the reasonableness of Contractor’s actions to remedy such breach or complete the performance of its obligations. m. Upon request of the Owner, the Contractor shall submit to County all relevant documentation, including but not limited to, job cost records, to support its claims for final compensation and if such request is made final compensation shall not be due until all relevant documentation is received, reviewed, and approved by Owner. 12. CONSEQUENTIAL AND LIQUIDATED DAMAGES a. Owner and Contractor mutually waive any claim against each other for consequential damages. Consequential Damages include: Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 8 i. Damages incurred by Owner for loss of use, income, financing, or business. ii. Damages incurred by Contractor for office expenses, including personnel, loss of financing, profit, income, business, damage to reputation, or any other non-direct damages. b. Liquidated damages shall be in accord with the Contract Documents. If the Contract Documents do not otherwise address liquidated damages, such damages shall be in the amount of five hundred dollars ($500.00) per day. 13. TERMINATION OR SUSPENSION a. The Owner may, without cause, order the Contractor to terminate, suspend, delay or interrupt the Work in whole or in part for such period of time as the Owner may determine. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is not due to or as a result of any fault on the part of the Contractor or any subcontractor, the Contractor may recover a per diem amount of five hundred dollars ($500.00) per day with a not-to-exceed limit of ten thousand dollars ($10,000.00). ii. In the event of termination by the Owner under this Agreement, the Contractor shall be entitled to receive its reasonable and documented direct costs incurred prior to the date Owner mails the notice of termination, including the cost of materials purchased for the Work, but only if such purchases cannot be canceled, or materials returned, or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the work in a safe and efficient manner. iii. If Owner elects to suspend or terminate the contract pursuant to subparagraphs 13.a.i. or 13 a.ii. the sole remedy available to the Contractor are those listed in said subparagraphs and Contractor is not entitled to any right to further claims for any amount owed or disputed or for payment of damages alleged to have been sustained as a result of Owner’s order to delay, suspend, or interrupt the Work. b. The Owner may, with cause, order the Contractor to suspend, delay or interrupt the Work in whole or in part for such period of time as the cause remains. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is due to or as a result of any fault on the part of the Contractor or any subcontractor, the Owner may reduce payment at a per diem amount of five hundred dollars ($500.00) per day for the full duration of the delay, suspension, or interruption. c. Contractor may terminate the Contract if, at the Owner’s written direction, the Work is stopped for thirty (30) consecutive days through no act or fault of the Contractor, their agents or employees, or a subcontractor or their agents or employees or any other person performing work pursuant to the Contract Documents. Contractor may terminate the Contract if a Court or other Public authority having jurisdiction enters a lawful order that Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 9 requires all work to be stopped and such stoppage lasts for thirty (30) consecutive days. d. Either party may terminate this Agreement upon notice to the other party that obligations pursuant to this Agreement are made impossible due to declarations of emergency by Orange County or by North Carolina due to events directly impacting Orange County. Both parties shall remain responsible for all payment and performance due up to the receipt of such notice, but shall have no further obligation or responsibility beyond that date provided the terminating party has taken all reasonable steps to complete the performance of its obligations. 14. ENTIRE AGREEMENT All of the documents listed, referenced or described in this Agreement, the written Notice-to- Proceed, together with Modifications made or issued in accordance herewith are the Contract Documents, and the work, labor, materials and completed construction required by the Contract Documents and all parts thereof is the Work. The Contract Documents constitute the entire agreement between Owner and Contractor. This Agreement may be amended only by written instrument signed by both parties. Modifications may be evidenced by facsimile signatures. If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. IN WITNESS WHEREOF, the Parties hereto have executed this Agreement as of the day and date first above written wholly or in a number of counterparts each of which shall, without proof or accounting for other counterparts, be deemed an original contract. ORANGE COUNTY CONTRACTOR ____________________________________ ________________________________________ Signature Signature County Manager ________________________________________ Printed Name and Title Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 10 ORANGE COUNTY—INTERNAL USE ONLY ______________________________________________________________________________ Finance Information Vendor Name: Vendor Contact Person: Phone: Address: City State: Zip: Department: Amount: Purpose: Budget Code(s): Vendor # Vendor Status with NCSOS: Vendor is a BOCC consultant: Yes No Contract Details Contract Type: New Amendment (Original Contract: ) (Most Recent Amendment ) Effective Date End Date Notice Date (Notice Purpose ) Award Approved by Board (Agenda Date: ); Made or Administered by Signature Authority - BOCC Express Delegation (Agenda Date: ) - Policy 9.4: Under $5,000; Service Under $90,000; Construction Under $250,000 - Budget Policy Section XV (Capital Improvement Project: ) Bidding Informal Bidding ($30k-$90k); Formal RFP ($90k+); Other (<$30k); Exception(# ) Department Affirmation This agreement is approved as to technical form and content and I as Department Director affirmatively state work on this project has not been initiated prior to execution of the agreement; OR This agreement is approved as to technical form and content. Services related to this agreement have already begun or been completed. Description of the nature of the emergency condition that was addressed: Department Director’s Signature ________________________________________ Date: ________ Information Technologies This agreement has been reviewed and is approved as to information technology content and specifications: Office of the Chief Information Officer___________________________________ Date: ________ Inapplicable because no hardware/software purchases or related services Risk Management This agreement is approved for sufficiency of insurance standards, specifications, and requirements: Office of the Risk Management Officer___________________________________ Date: _________ Financial Services This instrument has been pre-audited in the manner required by the Local Government Budget and Fiscal Control Act: Office of the Chief Financial Officer ____________________________________ Date: _________ Legal Services This agreement is approved as to legal form and sufficiency: Office of the County Attorney __________________________________________Date: ________ Clerk to the Board All Docusign contracts must be copied to the Clerk upon completion: occlerkdocs@orangecountync.gov The following signature block is for hard copies only and is not required for Docusign contracts: Received for record retention: Office of the Clerk to the Board __________________________________________Date:_________ Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 ORANGE COUNTY NORTH CAROLINA DISPUTE RESOLUTION RULES AND PROCEDURES FOR ORANGE COUNTY DESIGN, BUILDING CONSTRUCTION, RENOVATION, AND REPAIR PROJECTS RULE 1. INITIATING MEDIATED SETTLEMENT CONFERENCES A. Purpose of Mandatory Settlement Conferences. Pursuant to G.S. §143-128(f1) and 143- 135.26(11), these Rules are promulgated to implement a mediated settlement program designed to focus the parties’ attention on settlement rather than on claim preparation and to provide an opportunity for orderly settlement negotiations to take place. Nothing herein is intended to limit or prevent the parties from engaging in settlement procedures voluntarily at any time prior to or during commencement of the dispute resolution process. B. Initiating the Dispute Resolution Process 1. Any party to a County public construction contract (referred to herein generally as the “Contract”) governed by Article 8. Ch. 143 of the General Statutes and identified in G.S. § 143- 128(f1) and who is a party to a dispute arising out of the Contract and the construction process in which the amount in controversy is at least $15,000 may submit a written request to the County for mediation of the dispute. 2. Prior to submission of a written request for mediation to the County, the party requesting mediation should give notice of any and all claims in accordance with their respective contracts, obtain decisions on the claims as required or allowed by their respective contracts, and attempt to resolve the dispute according to the terms and conditions in their respective contracts. The Mediator may adjourn any mediated settlement conference if the Mediator believes, in his or her sole discretion, that the parties have not satisfied all of the terms and conditions of their respective contracts and that doing so will enhance the prospects for a negotiated settlement. C. Condition Precedent to Litigation. Before any party to a Contract may commence a civil action against the County seeking remedies for breach or non-performance of the Contract by the County, said party must first initiate the dispute resolution process under these rules and attend and participate in good faith in the mediated settlement conference. RULE 2. SELECTION OF MEDIATOR A. Mediator Listing. A List of Mediators acceptable to the County is maintained by the County Attorney and that list is incorporated by reference into these Rules. B. Selection of Mediator. The party requesting mediation shall select a Mediator from the List of Mediators and shall file, with the County, a Notice of Selection of Mediator within 21 days of the request for mediation. Such notice shall state the name, address, and phone number of the Mediator selected. If Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 the Mediator selected is not available or declines to participate for any reason, the requesting party shall select another person from the List of Mediators. If the party requesting mediation does not select and designate a mediator within 21 days of the request for mediation, the County shall have the right in its absolute discretion to appoint a mediator from its List of Mediators. C. Disqualification of Mediator. Any party may request replacement of the Mediator for good cause. Nothing in this provision shall preclude Mediators from disqualifying themselves. RULE 3. THE MEDIATED SETTLEMENT CONFERENCE A. Where Conference is to be Held. Unless all parties and the Mediator otherwise agree, the mediated settlement conference shall be held in county seat of Orange County. The Mediator shall be responsible for reserving a place, making arrangements for the conference, and giving timely notice of the time and location of the conference to all attorneys, unrepresented parties and other persons or entities required to attend. B. When Conference is to be Held. The mediation shall be completed within 90 days after selection of the Mediator unless all parties to the mediation agree to a different schedule. C. Request to Accelerate or Extend Deadline for Completion. Any party or the Mediator may request the County to accelerate or extend the deadline for completion of the conference. Such request shall state the reasons the acceleration or extension is sought and shall be served by the moving party upon the other parties and the Mediator. Objections to the request must be promptly communicated to the County and to the Mediator. The County, with the concurrence of the designated Mediator, may grant the request by adjusting the time for completion of the conference. D. Recesses. The Mediator may recess the mediation conference at any time and may set times for reconvening. If the Mediator determines the time and place where the conference is to reconvene before the conference is recessed, no further notice is required to persons present at the conference. E. Project Delay. The mediated settlement conference that results from a construction contract dispute shall not be cause for the delay of the construction project. RULE 4. DUTIES OF PARTIES AND OTHER PARTICIPANTS IN FORMAL DISPUTE RESOLUTION PROCESS A. Attendance. 1. All parties to the dispute must designate an official representative to attend the mediation. 2. “Attendance” means physical attendance, not by telephone or other electronic means. Any attendee representing a party must have authority from that party to bind it to any agreement reached as a result of the mediation. 3. Attorneys representing parties may attend the mediation, but are not required to do so. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 4. Sureties and insurance company representatives are required to physically attend the mediation unless the Mediator and all of the other parties to the mediation excuse their attendance or consent to their attendance by telephone or other electronic means. 5. The parties who attend a duly scheduled mediation conference shall have the right to recover their share of the Mediator’s compensation from any party or parties who fail to attend the conference without good cause. B. Finalizing Agreement. If an agreement is reached in the conference, the terms of the agreement shall be confirmed in writing and signed by all parties. C. Payment of Mediation Fee: Mediation Fees charged by the Mediator shall be paid in accordance with G.S. § 143-128(f1). D. Failure to Compensate Mediator. Any party’s failure to compensate the Mediators in accordance with G.S. § 143-128(f1) shall subject that party to a withholding by the County of said amount of money from the party’s payment or any other moneys owed by that party to the County. Should the County fail to compensate the Mediator, it shall hereby be subject to a civil cause of action from the Mediator for the County’s portion of the Mediator’s total fee as required by G.S. § 143-128(f1). RULE 5. AUTHORITY AND DUTIES OF MEDIATORS A. Authority of Mediator. 1.Control of Conference. The Mediator shall at all times be in control of the conference and the procedures to be followed. 2.Private Consultation. The Mediator may communicate privately with any participant or counsel prior to and during the conference. The fact that private communications have occurred with a participant shall be disclosed to all other participants at the beginning of the conference. 3.Scheduling the Conference. The Mediator shall make a good faith effort to schedule the conference at a time that is convenient with the participants, attorneys and Mediator. In the absence of agreement, the Mediator shall select the date for the conference. 4.Determining good cause for a party’s failure to appear at a scheduled mediation conference. B.Duties of Mediator. 1.The Mediator shall define and describe the following at the beginning of the conference: a.The process of mediation. b.The difference between mediation and other forms of conflict resolution. c.The costs of the mediated settlement conference. d.That the mediated settlement conference is not a trial, the Mediator is not a judge, and the parties retain their legal rights if they do not reach settlement; however, the Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 Mediator will advise all parties that failure to appear at mediation without good cause may result in imposition of sanctions and may be asserted as a bar to lawsuits by claimants who have failed to exhaust this administrative remedy. e.The circumstances under which the Mediator may meet and communicate privately with any of the parties or with any other person. f.Whether and under what conditions communications with the Mediator will be held in confidence during the conference. g.The inadmissibility of conduct and statements as provided by G.S. §7A-38.1(1). h.The duties and responsibilities of the Mediator and the participants. i.That any agreement reached will be reached by mutual consent. 2. Disclosure: The Mediator has a duty to be impartial and to advise all participants of any possible bias, prejudice or partiality. 3. Declaring Impasse: The Mediator may determine at any time during the mediation conference that an impasse exists and that the conference should end. 4. Reporting Results of Conference. The Mediator shall submit a written report to the County and the other parties within 10 days of the conference stating whether or not the parties reached an agreement. The Mediator’s report shall indicate the absence of any party from the mediated settlement conference without permission or good cause. 5. Scheduling and Holding the Conference. It is the duty of the Mediator to schedule the conference and conduct it prior to the deadline of completion set by the rules. The Mediator shall strictly observe deadlines for completion of the conference unless said time limit is changed by agreement of the parties. RULE 6. COSTS AND COMPENSATION OF THE MEDIATOR The Parties shall compensate the Mediator for mediation services at the rate proposed by the Mediator and agreed to by the parties at the time the Mediator is selected. The Parties shall be jointly responsible for the Mediator’s costs and expenses subject to Rule 4.C. above. Each Party is responsible for its own costs and expenses, including reasonable attorneys’ fees, related to the Meiation. RULE 7. RULE MAKING These Rules may be amended by the County at any time. Amendments will not affect mediations where claims or requests for mediation have been filed at the time the amendment takes effect . RULE 8. DEFINITIONS A. “County” shall mean Orange County North Carolina. B. “Project Designer” is that person or firm stipulated as project designer in the Contract Documents for the project. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 C. “Claim” is a demand or assertion by a party seeking adjustment or interpretation of Contract terms, payment of money, extension of time or other relief with respect to the terms of the Contract. The term “Claim” also includes other disputes and matters in question between the parties to a Contract involved in the County’s building construction renovation and repair projects arising out of or relating to the Contract or the construction process. Claims must be initiated by a written notice. The responsibility to substantiate Claims shall rest with the party making the Claim. D. “Good Cause” generally includes any circumstance beyond the control of a party, which prevents that party from meeting obligations. When good cause is asserted as an excuse for a party’s failure to appear at a mediation conference or to otherwise comply with the requirements of these Rules, the Mediator, in his or her sole discretion, will determine whether good cause exists to excuse the party’s failure to appear or otherwise comply with these rules. RULE 9. TIME LIMITS A. Any time limit provided for by these Rules may be waived or extended at the sole discretion of the County, if no Mediator has been selected, and at the discretion of the County with concurrence of the Mediator if a Mediator has been selected. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Section I: General Government and Administration Policy 10.0: Living Wage Contractor Policy Reviewed by: County Attorney/County Manager Approved by: County Manager Original Effective Date: April 21, 2016 Revisions: August 1, 2016 Policy Statement It is the policy of Orange County to ensure its employees, and all individuals who provide services for Orange County, are paid a living wage. Purpose To encourage all vendors and contractors to pay a living wage to all employees who perform work pursuant to a contract with Orange County. Applicability Applies to all Orange County contracts and purchases. Policy 10.1 Living Wage 10.1.1 Orange County is committed to providing its employees with a living wage and encourages all contractors and vendors doing business with Orange County to pursue the same goal. Orange County’s living wage is as reflected in the adopted Orange County Budget and as that budget document is amended from time to time. To the extent possible, Orange County recommends that contractors and vendors seeking to do business with Orange County provide a living wage to their employees. 10.1.2 Prior to final execution of a contract with Orange County all contractors and vendors seeking to do business with Orange County shall submit to the County’s representative a statement indicating whether those employees who will perform work on the Orange County contract are paid at least the living wage amount set out above. If such employees do not make at least the living wage amount set out above the contractor or vendor shall indicate in the statement the actual amount paid to such employees. For bid projects this statement should be submitted as part of the bid packet. This policy may be reviewed annually and updated as needed by the Manager’s Office Acknowledged Receipt by: ____________________________________________________ Company Name: ____________________________________________________________ Date: ___________________________________________________________________ Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 STATE OF NORTH CAROLINA AFFIDAVIT ORANGE COUNTY ************************** I, ____________________________(the individual attesting below), being duly authorized by and on behalf of ________________________________ (the entity bidding on project hereinafter "Employer") after first being duly sworn hereby swears or affirms as follows: 1. Employer understands that E-Verify is the federal E-Verify program operated by the United States Department of Homeland Security and other federal agencies, or any successor or equivalent program used to verify the work authorization of newly hired employees pursuant to federal law in accordance with NCGS §64-25(5). 2. Employer understands that Employers Must Use E-Verify. Each employer, after hiring an employee to work in the United States, shall verify the work authorization of the employee through E-Verify in accordance with NCGS§64-26(a). 3. Employer is a person, business entity, or other organization that transacts business in this State and that employs 25 or more employees in this State. (mark Yes or No) a. YES _____, or b. NO _____ 4. Employer's subcontractors comply with E-Verify, and if Employer is the winning bidder on this project Employer will ensure compliance with E-Verify by any subcontractors subsequently hired by Employer. This ____ day of _______________, 20__. Signature of Affiant Print or Type Name: _________________________ State of North Carolina, _________ County Signed and sworn to (or affirmed) before me, this the _____ day of ________________, 20__. My Commission Expires: Notary Public (Affix Official/Notarial Seal) Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Chapter 12 Civil Rights. Sections 12-23 – 12-49 Reserved. AN ORDINANCE PROHIBITING DISCRIMINATION THROUGHOUT ORANGE COUNTY Sec. 12-50. - Title. This Ordinance shall be known and may be cited as the Orange County Non-Discrimination Ordinance. Sec. 12-51. – Policy and Severability. (a) It is the policy of Orange County not to enter into a contract with any business, company, or firm that has discriminated in the solicitation, selection, hiring or treatment of vendors, suppliers, subcontractors or commercial customers against a Protected Class, or on the basis of any otherwise unlawful use of individual or personal characteristics regarding such vendor's, suppliers, commercial customers, employees, or owners in connection with a county contract or solicitation; provided that nothing in this non-discrimination policy shall prohibit or limit otherwise lawful efforts to remedy the effects of discrimination that has occurred or is occurring in the marketplace. 1. It is the policy of Orange County that every Orange County created contract and subcontract for goods or services shall contain a non-discrimination clause that prohibits discrimination as that term is defined herein. (b) It is further the policy of Orange County that discrimination has no place in Orange County, North Carolina and it is the intent of this ordinance to provide uniform legal protection to individuals in all Protected Classes, making it unlawful for any person to discriminate in housing, public accommodations, and transportation. (c) Should any provision of this Ordinance be found to be unconstitutional by a court of law such provision shall be severed from the remainder of the Ordinance and such action shall not affect the enforceability of the remaining provisions of the Ordinance. Sec. 12-52. - Definitions. (a) Discrimination means any disadvantage, difference, or distinction in the solicitation, selection, hiring, service to, or treatment of a vendor, supplier, subcontractor, or customer on the basis of Protected Class status or on the basis of any otherwise unlawful use of personal or individual characteristics. (b) Housing and public accommodations have the same common meaning as those terms are defined in the Orange County Civil Rights Ordinance. (c) Person means any individual, business, or company, regardless of organizational structure, providing for profit goods, facilities, services, accommodations, transportation, or access to the general public. (d) Protected Class means age (as defined in the Orange County Civil Rights Ordinance), race, ethnicity, color, national origin, religion, creed, sex, sexual orientation, gender, gender identity, gender expression, marital status, familial status, source of income, disability, political affiliation, veteran status, disabled veteran status. (e) Public Accommodation has the same meaning as that term is defined in the Orange County Civil Rights Ordinance except that for purposes of this Ordinance Public Accommodation includes: 1. Transportation companies and transportation providers operating company-owned or privately- Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 owned vehicles providing transportation to the general public; and 2. Private residences providing short-term rentals to members of the general public. A short-term rental means the provision of a room, space, or residential unit that is suitable or intended for occupancy for dwelling, sleeping, or lodging purposes, for a period of fewer than 30 consecutive days, in exchange for a charge for the occupancy. Sec. 12-53. - Contractor bid requirements. (a) All requests for bids or proposals issued for county contracts shall include a certification to be completed by the bidder or proposer in substantially the following form: The undersigned bidder or proposer hereby certifies and agrees that the following information is correct: 1. In preparing its enclosed bid or proposal, the bidder or proposer has considered all bids and proposals submitted from qualified, potential subcontractors and suppliers, and has not engaged in discrimination as defined in Section 12-52 of the Orange County Non- discrimination Ordinance. 2. Without limiting any other remedies that Orange County may have for a false certification, it is understood and agreed that, if this certification is false, such false certification will constitute grounds for Orange C ounty to reject the bid or proposal submitted with this certification, and terminate any contract awarded based on such bid or proposal. It shall also subject the bidder or proposer to disqualification from participating in county contracts or bid processes for up to two years. 3. As a condition of contracting with Orange County, the bidder or proposer agrees to promptly provide to Orange County all information and documentation that may be requested by Orange County from time to time regarding the solicitation and selection of suppliers and subcontractors in connection with this solicitation process. Failure to maintain or failure to provide such information constitutes grounds for Orange County to reject the bid or proposal and to terminate, without penalty to Orange County, any contract awarded on such bid or proposal. All such information and documentation shall be maintained for a period of three years after the expiration of the contract. 4. As part of its bid or proposal, the bidder or proposer shall provide to Orange County a list of all instances within the past ten years where a complaint was filed or pending against bidder or proposer in a legal or administrative proceeding alleging that bidder or proposer discriminated against its subcontractors, vendors, suppliers, or commercial customers, and a description of the status or resolution of that complaint, including any remedial action taken. 5. As a condition of submitting a bid or proposal to Orange County the bidder or proposer agrees to comply with the Orange County Non-discrimination Ordinance. Falsification of this certification shall constitute a violation of the Orange County Non-Discrimination Ordinance and shall be grounds for rejection of the bid or proposal or termination, without fault to Orange County, of a contract. 6. As a condition of submitting a bid or proposal to Orange County the bidder or proposer agrees that Orange County may consider the information submitted as part of this certification in its determination of the responsibility of the bidder or proposer. The bidder or proposer, as the case may be, waives the right to challenge the rejection of a bid or proposal when such rejection is based, in its entirety, on information contained in this certification. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Sec. 12-54. - Prohibited acts. (a) It shall be unlawful for any person to deny any person the full and equal enjoyment of the goods, services, facilities, privileges, advantages, and accommodations of a place of public accommodation on the basis of Protected Class status or on the basis of any otherwise unlawful use of individual or personal characteristics. (b) It shall be unlawful for any person to make, print, circulate, post, mail or otherwise cause to be published a statement, advertisement, or sign which indicates that the full and equal enjoyment of the transportation, access, goods, services, facilities, privileges, advantages, and accommodations of a place of public accommodation will be refused, withheld from, or denied any person on the basis of Protected Class status or on the basis of any otherwise unlawful use of individual or personal characteristics, or that any person's patronage of or presence at a place of public accommodation is objectionable, unwelcome, unacceptable, or undesirable on the basis of Protected Class status or on the basis of any otherwise unlawful use of individual or personal characteristics; provided, however, this section does not apply to a private club or other establishment not, in fact, open to the public. (c) It shall be unlawful for any person to intentionally or knowingly: 1. Perform or attempt to perform any act which directly or indirectly results in an individual's bodily injury or property damage where such act is directed at an individual or a group of individuals because of that person's or that group's perceived or actual Protected Class status or on the basis of any otherwise unlawful use of individual or personal characteristics. 2. Solicit, encourage, compensate, assist, or conspire with another to perform or attempt to perform any act which directly or indirectly results in an individual's bodily injury or property damage where such act is directed at an individual or a group of individuals because of that person's or that group's perceived or actual Protected Class status or on the basis of any otherwise unlawful use of individual or personal characteristics. (d) No person shall be found to have violated this Ordinance solely on the basis of the content of any speech or communication used by such person. Sec. 12-55. Exemptions. (a) All applicable exemptions found in Section 12-11 of the Orange County Civil Rights Ordinance related to housing shall apply to alleged violations of Section 12-54 of this Ordinance. Sec. 12-56. Investigation, Enforcement, and Remedy. (a) Sections 12-16 through and including 12-21 of the Orange County Civil Rights Ordinance shall be followed and adhered to during the investigation of any alleged violation of this Ordinance. Any remedies available through said sections of the Orange County Civil Rights Ordinance shall be available hereunder. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ORANGE COUNTY NONDISCRIMINATION CERTIFICATION The undersigned bidder or proposer hereby certifies and agrees that the following information is correct: 1. In preparing its enclosed bid or proposal, the undersigned bidder or proposer has considered all bids and proposals submitted from qualified, potential subcontractors and suppliers, and has not engaged in discrimination as defined in Section 12-52 of the Orange County Non-discrimination Ordinance. 2. Without limiting any other remedies that Orange County may have for a false certification, it is understood and agreed that, if this certification is false, such false certification will constitute grounds for Orange County to reject the bid or proposal submitted with this certification, and terminate any contract awarded based on such bid or proposal. It shall also subject the bidder or proposer to disqualification from participating in county contracts or bid processes for up to two years. 3. As a condition of contracting with Orange County, the undersigned bidder or proposer agrees to promptly provide to Orange County all information and documentation that may be requested by Orange County from time to time regarding the solicitation and selection of suppliers and subcontractors in connection with this solicitation process. Failure to maintain or failure to provide such information constitutes grounds for Orange County to reject the bid or proposal and to terminate, without penalty to Orange County, any contract awarded on such bid or proposal. All such information and documentation shall be maintained for a period of three years after the expiration of the contract. 4. As part of its bid or proposal, the undersigned bidder or proposer shall provide to Orange County a list of all instances within the past ten years where a complaint was filed or pending against bidder or proposer in a legal or administrative proceeding alleging that bidder or proposer discriminated against its subcontractors, vendors, suppliers, or commercial customers, and a description of the status or resolution of that complaint, including any remedial action taken. 5. As a condition of submitting a bid or proposal to Orange County the undersigned bidder or proposer agrees to comply with the Orange County Non-discrimination Ordinance. Falsification of this certification shall constitute a violation of the Orange Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 County Non-Discrimination Ordinance and shall be grounds for rejection of the bid or proposal or termination of an existing contract, without fault or further obligation to Orange County. 6. As a condition of submitting a bid or proposal to Orange County the undersigned bidder or proposer agrees that Orange County may consider the information submitted as part of this certification in its determination of the responsibility of the undersigned bidder or proposer. The undersigned bidder or proposer, as the case may be, waives the right to challenge the rejection of a bid or proposal when such rejection is based, in its entirety, on information submitted as part of this certification. The bidder or proposer certifies the undersigned has full authority to sign on its behalf. By:________________________________________ ___________________________________________ Printed Name and Title On behalf of _________________________________ ___________________________________________ Company or Corporate name Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Supplemental Vendor Information: HISTORICALLY UNDERUTILIZED BUSINESSES Historically Underutilized Businesses (HUBs) consist of minority, women and disabled business firms that are at least fifty-one percent owned and operated by an individual(s) of the categories. Also included in this category are disabled business enterprises and non-profit work centers for the blind and severely disabled. Pursuant to G.S. 143B-1361(a), 143-48 and 143-128.4, the County invites and encourages participation in this procurement process by businesses owned by minorities, women, disabled, disabled business enterprises and non-profit work centers for the blind and severely disabled. This includes utilizing subcontractors to perform the required functions in this RFP/RFQ. Any questions concerning NC HUB certification, contact the North Carolina Office of Historically Underutilized Businesses at (919) 807- 2330. The Vendor shall respond to question #1 and #2 below. 1) Is Vendor a Historically Underutilized Business? Yes No 2) Is Vendor Certified with North Carolina as a Historically Underutilized Business? Yes No If so, state HUB classification: ____________________________________________________________ Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 MINORITY BUSINESSES PARTICIPATION REQUIREMENTS Orange County has established a verifiable ten percent (10%) minority business participation goal for the total monetary value of this project. Verifiable goal means that the awarding authority has adopted written guidelines specifying the actions that the prime contractor must take to ensure a good faith effort in the recruitment and selection of minority businesses for participation in contracts awarded; the required actions must be documented in writing by the contractor to the appropriate awarding authority. These guidelines are published to accomplish that end. DEFINITIONS: Minority - a person who is a citizen or lawful permanent resident of the United States and who is: a. Black, that is, a person having origins in any of the black racial groups in Africa; b. Hispanic, that is, a person of Spanish or Portuguese culture with origins in Mexico, South or Central America, or the Caribbean Islands, regardless of race; c. Asian American, that is, a person having origins in any of the original peoples of the Far East, Southeast Asia and Asia, the Indian subcontinent, the Pacific Islands; d. American Indian or Alaskan Native, that is, a person having origins in any of the original peoples of North America; or e. Female. Socially and Economically Disadvantaged Individual: Socially disadvantaged individuals are those who have been subjected to racial or ethnic prejudice or cultural bias because of their identity as a member of a group without regard to their individual qualities. Economically disadvantaged individuals are those socially disadvantaged individuals whose ability to compete in the free enterprise system has been impaired due to diminished capital and credit opportunities as compared to others in the same business area who are not socially disadvantaged. Minority Business - means a business: a. In which at least fifty-one percent (51%) is owned by one or more minority persons, or in the case of a corporation, in which at least fifty-one percent (51%) of the stock is owned by one or more minority persons; and b. Of which the management and daily business operations are controlled by one or more of the minority persons who own it; and c. Is certified in one of the MWBE categories as defined by the NC Department of Administration/Historically Underutilized Business (HUB) and the NC Department of Transportation/Disadvantaged Business Enterprise (DBE). Bidder Responsibilities: Under the single prime contract system, the prime contractor will: a. Attend the scheduled Prebid conference. b. Identify or determine those work areas of a contract where MBEs may have an interest in performing contract work. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 c. At least ten (10) days prior to the scheduled day of bid opening, notify certified MBEs of potential contracting opportunities listed in the proposal. The notification will include the following: 1. A description of the work for which the bid is being solicited. 2. The date, time and location where bids are to be submitted. 3. The name of the individual within the agency/institution who will be available to answer questions about the project. 4. Where bid documents may be reviewed. 5. Any special requirements that may exist, such as insurance, licenses, bonds and financial arrangements. d. During the bidding process, comply with the contractor(s) requirements listed in the proposal for minority participation. e. Submit with the bid a description of that portion of the work to be executed by MBEs expressed as a percentage of the total price. f. Identify the MBEs the bidder intends to use on the contract, along with the dollar amount of the work to be performed by each minority business. g. Submit an affidavit that details the good faith efforts taken to procure minority business participation. h. Upon being named the apparent low bidder, the bidder shall provide the necessary documentation as listed in the contract documents. Failure to comply with procedural requirements as defined in contract documents may render that bid as non-responsive and may result in rejection of the bid and award to the next lowest responsible and responsive bidder. i. Upon being named apparent low bidder, the bidder shall provide an affidavit that lists the proportion of the work to be performed by MBEs. If the MBEs do not account for ten percent (10%) of the contract price, the bidder must submit an affidavit that verifies the bidder’s good faith efforts by certifying that it has undertaken at least five of the following ten (10) steps: 1. Contacted minority businesses that reasonably could have been expected to submit a quote and that were known to the contract or available on these State or local government-maintained lists at least ten (10) days before the bid or proposal date and notifying them of the nature and scope of the work to be performed. 2. Made the construction plans, specifications, and requirements available for review by prospective minority businesses, or providing these documents to them at least ten (10) days before the bid proposals are due. 3. Broke down or combined elements of work into economically feasible units to facilitate minority participation. 4. Worked with minority trade, community, or contractor organizations identified by the Office of Historical Underutilized Businesses and included in the bid documents that provided assistance in recruitment of minority businesses. 5. Attended any prebid meetings scheduled by the public owner. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 6. Provided assistance in getting required bonding or insurance or providing alternatives to bonding or insurance for subcontractors. 7. Negotiated in good faith with interested minority businesses and did not reject them as unqualified without sound reasons based on their capabilities. Any rejection of a minority business based on lack of qualifications should have the reasons documented in writing. 8. Provided assistance to an otherwise qualified minority business in need of equipment, loan capital, lines of credit, or joint pay agreements to secure loans, supplies, or letters of credit, including waiving credit that is ordinarily required. Assisted minority businesses in obtaining the same unit pricing with the bidder’s suppliers in order to help the minority businesses in establishing credit. 9. Negotiated joint venture and partnership arrangements with minority businesses in order to increase opportunities for minority business participation on a public construction or repair project when possible. 10. Provide quick pay agreements and policies to enable minority contractors and suppliers to meet cash-flow demands. j. During the construction of the project, if it becomes necessary to replace an MBE subcontractor, advise the owner of the circumstances involved. k. If, during the construction of a project, additional subcontracting opportunities become available, make a good faith effort to solicit subbids from MBEs. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. Coverage Low Risk Profile Standard Risk Profile High Risk Profile Specialty Encroachment Premises Lease Commercial General Liability Products/Completed Operation Explosion, Collapse & Underground (XCU) $1,000,000/$2,000,000 Per accident As above $1,000,000/$2,000,000 As Above If any, Limit to be determined. $1,000,000/$2,000,000 As above If any, TBD. $1,000,000* As Above If any, TBD. $1,000,000 $1,000,000 Automobile Liability $1,000,000 (CSL) Per occurrence $1,000,000* $1,000,000* $1,000,000* N/A N/A **Workers’ Compensation Statutory Statutory Statutory Statutory N/A Statutory **Employer’s Liability 100/500/100 500/500/500* 500/500/500 500/500/500* N/A 100/500/100 ** Waiver of Subrogation on WC Required if available Required if available Required Required N/A N/A Umbrella Liability $1,000,000 $2,000,000 $2,000,000+ $9,000,000+ N/A N/A Professional Liability may be required on a risk profile depending on nature of services provided by contract. Coverage required for professional service such as accountant, attorney, architect, design, engineering, health care and most consultants. $1,000,000 per occurrence $1,000,000 TBD TBD N/A N/A Sexual Misconduct (Sexual Abuse/Molestation) may be required for contractors working directly one-on- one with children and elderly or in overnight sheltering capacities. $1,000,000/$2,000,000 $1,000,000/$2,000,000 TBD TBD N/A TBD Cyber Liability may be required for contractors having access to personal identifying information, and/or computer networks. $1,000,000/$2,000,000 TBD TBD TBD N/A Environmental/Pollution Liability required if demolition, use of N/A $1,000,000 $1,000,000+* $1,000,000+* N/A N/A Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. hazardous material or environmentally sensitive Fidelity Bond (loss of money or other property due to dishonest acts). Only for contracts such as Banking, Janitorial, Fundraising, TPA’s and similar, ETA TBD Amount depends on exposure to loss TBD TBD N/A N/A Other Coverage As required TBD TBD TBD TBD N/A N/A Bid, Performance & Payment Bonds TBD TBD TBD TBD N/A N/A *A combination of Umbrella/Excess and primary limit may be used to provide coverage for the amount shown. ** Workers’ Compensation is required if the contractor/vendor has employees. Owner Waiver is acceptable for a Sole Proprietor. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Price and Payment Procedures 01 20 00 - 1 SECTION 01 20 00 PRICE AND PAYMENT PROCEDURES PART 1 GENERAL 1.01 SECTION INCLUDES A.Procedures for preparation and submittal of applications for progress payments. B.Documentation of changes in Contract Sum and Contract Time. C.Procedures for preparation and submittal of application for final payment. 1.02 SCHEDULE OF VALUES A.Use Schedule of Values Form: AIA G703. B.Electronic media printout including equivalent information will be considered in lieu of standard form specified;submit draft to Architect for approval. C.Forms filled out by hand will not be accepted. D.Submit Schedule of Values in duplicate within 20 days after date of Owner-Contractor Agreement. E.Format: Utilize the Table of Contents of this Project Manual.Identify each line item with number and title of the specification section. Identify site mobilization. F.Revise schedule to list approved Change Orders,with each Application For Payment. 1.03 APPLICATIONS FOR PROGRESS PAYMENTS A.Payment Period: Submit at intervals stipulated in the General and Supplementary Conditions. B.Use Form AIA G702 and Form AIA G703. C.Forms filled out by hand will not be accepted. D.Execute certification by signature of authorized officer. E.Use data from approved Schedule of Values. Provide dollar value in each column for each line item for portion of work performed and for stored products. F.List each authorized Change Order as a separate line item,listing Change Order number and dollar amount as for an original item of work. G.Submit one electronic and three hard-copies of each Application for Payment. H.Include the following with the application: 1.Transmittal letter as specified for submittals in Section 01 30 00. 2.Construction progress schedule,revised and current as specified in Section 01 30 00. 3.State Tax form if required 1.04 MODIFICATION PROCEDURES A.For minor changes not involving an adjustment to the Contract Sum or Contract Time,Architect will issue instructions directly to Contractor. B.For changes for which advance pricing is desired,Architect will issue a document that includes a detailed description of a proposed change with supplementary or revised drawings and specifications,a change in Contract Time for executing the change with a stipulation of any overtime work required and the period of time during which the requested price will be considered valid. Contractor shall prepare and submit a fixed price quotation within 7 days. C.Computation of Change in Contract Amount: As specified in the Agreement and Conditions of the Contract. 1.05 APPLICATION FOR FINAL PAYMENT A.Prepare Application for Final Payment as specified for progress payments,identifying total adjusted Contract Sum,previous payments,and sum remaining due. B.Application for Final Payment will not be considered until the following have been accomplished: Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Price and Payment Procedures 01 20 00 - 2 1.All closeout procedures specified in Section 01 70 00. END OF SECTION 01 20 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Allowances 01 21 00 - 1 SECTION 01 21 00 ALLOWANCES PART 1 GENERAL 1.01 SECTION INCLUDES A.Contingency allowance. 1.02 CONTINGENCY ALLOWANCE A.Contractor's costs for products,delivery,installation,labor,insurance,payroll,taxes,bonding, equipment rental,overhead and profit will be included in Change Orders authorizing expenditure of funds from this Contingency Allowance. B.Funds will be drawn from the Contingency Allowance only by Change Order. C.At closeout of Contract,funds remaining in Contingency Allowance will be credited to Owner by Change Order. 1.03 ALLOWANCES SCHEDULE A.Contingency Allowance: Include the stipulated sum/price of $​15,000​for use upon Owner's instructions. PART 2 PRODUCTS -NOT USED PART 3 EXECUTION -NOT USED END OF SECTION 01 21 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Substitution Procedures 01 25 00 - 1 SECTION 01 25 00 SUBSTITUTION PROCEDURES PART 1 GENERAL 1.01 SECTION INCLUDES A.Procedural requirements for proposed substitutions. PART 2 PRODUCTS -NOT USED PART 3 EXECUTION 3.01 GENERAL REQUIREMENTS A.A Substitution Request for products,assemblies,materials,and equipment constitutes a representation that the submitter: 1.Has investigated proposed product and determined that it meets or exceeds the quality level of the specified product,equipment,assembly,or system. 2.Agrees to provide the same warranty for the substitution as for the specified product. 3.Agrees to coordinate installation and make changes to other work that may be required for the work to be complete,with no additional cost to Owner. 4.Waives claims for additional costs or time extension that may subsequently become apparent. B.Document each request with complete data substantiating compliance of proposed substitution with Contract Documents. Burden of proof is on proposer. C.Content: Include information necessary for tracking the status of each Substitution Request,and information necessary to provide an actionable response. 1.Forms indicated in the Project Manual are adequate for this purpose,and must be used. D.Limit each request to a single proposed substitution item. 1.Submit an electronic document,combining the request form with supporting data into single document. 3.02 SUBSTITUTION PROCEDURES DURING PROCUREMENT A.Submittal Time Restrictions: B.Submittal Form (before award of contract): 1.Submit substitution requests by completing the form attached to this section. See this form for additional information and instructions. Use only this form;other forms of submission are unacceptable. 3.03 RESOLUTION A.Architect may request additional information and documentation prior to rendering a decision. Provide this data in an expeditious manner. B.Architect will notify Contractor in writing of decision to accept or reject request. 3.04 ACCEPTANCE A.Accepted substitutions change the work of the Project. They will be documented and incorporated into work of the project by Change Order,Construction Change Directive,Architectural Supplementary Instructions,or similar instruments provided for in the Conditions of the Contract. END OF SECTION 01 25 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Administrative Requirements 01 30 00 - 1 SECTION 01 30 00 ADMINISTRATIVE REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A.Preconstruction meeting. B.Progress meetings. C.Construction progress schedule. D.Submittals for review,information,and project closeout. E.Number of copies of submittals. F.Requests for Interpretation (RFI)procedures. G.Submittal procedures. PART 2 PRODUCTS -NOT USED PART 3 EXECUTION 3.01 PRECONSTRUCTION MEETING A.Architect will schedule a meeting after Construction Contracts are finalized. B.Attendance Required: 1.Owner. 2.Architect. 3.Contractor. C.Agenda: 1.Execution of Owner-Contractor Agreement. 2.Submission of executed bonds and insurance certificates. 3.Distribution of Contract Documents. 4.Submission of list of subcontractors,list of products,schedule of values,and progress schedule. 5.Designation of personnel representing the parties to Contract and Engineer. 6.Procedures and processing of field decisions,submittals,substitutions,applications for payments,proposal request,Change Orders,and Contract closeout procedures. 7.Scheduling. D.Record minutes and distribute copies within two days after meeting to participants,with two copies to Architect,Owner,participants,and those affected by decisions made. 3.02 PROGRESS MEETINGS A.Schedule and administer meetings throughout progress of the work at maximum bi-monthly intervals. B.Make arrangements for meetings,prepare agenda with copies for participants,preside at meetings. C.Attendance Required: 1.Contractor. 2.Owner. 3.Architect. 4.Contractor's superintendent. 5.Major subcontractors. D.Agenda: 1.Review minutes of previous meetings. 2.Review of work progress. 3.Field observations,problems,and decisions. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Administrative Requirements 01 30 00 - 2 4.Identification of problems that impede,or will impede,planned progress. 5.Review of submittals schedule and status of submittals. 6.Maintenance of progress schedule. 7.Corrective measures to regain projected schedules. 8.Planned progress during succeeding work period. 9.Maintenance of quality and work standards. 10.Effect of proposed changes on progress schedule and coordination. 11.Other business relating to work. E.Record minutes and distribute copies within two days after meeting to participants,with two copies to Architect,Owner,participants,and those affected by decisions made. 3.03 CONSTRUCTION PROGRESS SCHEDULE -SEE SECTION 01 32 16 A.Within 10 days after date of the Agreement,submit preliminary schedule defining planned operations for the first 60 days of work,with a general outline for remainder of work. 3.04 SUBMITTALS FOR REVIEW A.When the following are specified in individual sections,submit them for review: 1.Product data. 2.Shop drawings. 3.Samples for selection. 4.Samples for verification. B.Submit to Architect for review for the limited purpose of checking for compliance with information given and the design concept expressed in Contract Documents. C.Samples will be reviewed for aesthetic,color,or finish selection. D.After review,provide copies and distribute in accordance with SUBMITTAL PROCEDURES article below and for record documents purposes described in Section 01 78 00 -Closeout Submittals. 3.05 SUBMITTALS FOR INFORMATION A.When the following are specified in individual sections,submit them for information: 1.Design data. 2.Certificates. 3.Test reports. 4.Inspection reports. 5.Manufacturer's instructions. 6.Manufacturer's field reports. 7.Other types indicated. B.Submit for Architect's knowledge as contract administrator or for Owner. 3.06 SUBMITTALS FOR PROJECT CLOSEOUT A.Submit Correction Punch List for Substantial Completion. B.Submit Final Correction Punch List for Substantial Completion. C.When the following are specified in individual sections,submit them at project closeout in compliance with requirements of Section 01 78 00 -Closeout Submittals: 1.Project record documents. 2.Operation and maintenance data. 3.Warranties. 4.Bonds. 5.Other types as indicated. D.Submit for Owner's benefit during and after project completion. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Administrative Requirements 01 30 00 - 3 3.07 NUMBER OF COPIES OF SUBMITTALS A.Electronic Documents: Submit one electronic copy in PDF format;an electronically-marked up file will be returned. Create PDFs at native size and right-side up;illegible files will be rejected. 1.PDFs are to be bookmarked with approriate sections. B.Samples: Submit the number specified in individual specification sections;one of which will be retained by Architect. 1.After review,produce duplicates. 2.Retained samples will not be returned to Contractor unless specifically so stated. 3.08 SUBMITTAL PROCEDURES A.General Requirements: 1.Use a single transmittal for related items. 2.Sequentially identify each item. For revised submittals use original number and a sequential numerical suffix. 3.Identify: Project;Contractor;subcontractor or supplier;pertinent drawing and detail number; and specification section number and article/paragraph,as appropriate on each copy. 4.Apply Contractor's stamp,signed or initialed certifying that review,approval,verification of products required,field dimensions,adjacent construction work,and coordination of information is in accordance with the requirements of the work and Contract Documents. 5.Deliver each submittal on date noted in submittal schedule,unless an earlier date has been agreed to by all affected parties,and is of the benefit to the project. a.Send submittals in electronic format via email to Architect. 6.Schedule submittals to expedite the Project,and coordinate submission of related items. a.For each submittal for review,allow 10 business days excluding delivery time to and from the Contractor. b.For sequential reviews involving Architect's consultants,Owner,or another affected party,allow an additional 7 days. 7.Identify variations from Contract Documents and product or system limitations that may be detrimental to successful performance of the completed work. 8.Provide space for Contractor and Architect review stamps. 9.When revised for resubmission,identify all changes made since previous submission. B.Shop Drawing Procedures: 1.Prepare accurate,drawn-to-scale,original shop drawing documentation by interpreting Contract Documents and coordinating related work. 2.Do not reproduce Contract Documents to create shop drawings. 3.Generic,non-project-specific information submitted as shop drawings do not meet the requirements for shop drawings. 3.09 SUBMITTAL REVIEW A.Submittals for Review: Architect will review each submittal,and approve,or take other appropriate action. B.Submittals for Information: Architect will not acknowledge receipt,and take no other action. C.Architect's actions will be reflected by marking each returned submittal using virtual stamp on electronic submittals. 1.Notations may be made directly on submitted items and/or listed on appended Submittal Review cover sheet. D.Architect's and consultants'actions on items submitted for review: 1.Authorizing purchasing,fabrication,delivery,and installation: a."Approved",or language with same legal meaning. b."Approved as Noted,Resubmission not required",or language with same legal meaning. 1)At Contractor's option,submit corrected item,with review notations acknowledged and incorporated. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Administrative Requirements 01 30 00 - 4 2)A corrected submittal shall be included in the closeout documents. c."Approved as Noted,Resubmit for Record",or language with same legal meaning. 1)Resubmit corrected item,with review notations acknowledged and incorporated. Resubmit separately,or as part of project record documents. 2.Not Authorizing fabrication,delivery,and installation: a."Revise and Resubmit". 1)Resubmit revised item,with review notations acknowledged and incorporated. b."Rejected". 1)Submit item complying with requirements of Contract Documents. E.Architect's and consultants'actions on items submitted for information: 1.Items for which no action was taken: a."Received"- to notify the Contractor that the submittal has been received for record only. 2.Items for which action was taken: a."Reviewed"-no further action is required from Contractor. END OF SECTION 01 30 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Construction Progress Schedule 01 32 16 - 1 SECTION 01 32 16 CONSTRUCTION PROGRESS SCHEDULE PART 1 GENERAL 1.01 SECTION INCLUDES A.Preliminary schedule. B.Construction progress schedule,bar chart type. 1.02 SUBMITTALS A.Within 10 days after date of Agreement,submit preliminary schedule. B.If preliminary schedule requires revision after review,submit revised schedule within 10 days. C.Within 20 days after review of preliminary schedule,submit draft of proposed complete schedule for review. D.Submit updated schedule with each Application for Payment. 1.03 SCHEDULE FORMAT A.Listings: In chronological order according to the start date for each activity. Identify each activity with the applicable specification section number. B.Diagram Sheet Size: Maximum 22 x 17 inches. PART 2 PRODUCTS -NOT USED PART 3 EXECUTION 3.01 PRELIMINARY SCHEDULE A.Prepare preliminary schedule in the form of a horizontal bar chart. 3.02 CONTENT A.Show complete sequence of construction by activity,with dates for beginning and completion of each element of construction. B.Identify each item by specification section number. C.Show accumulated percentage of completion of each item,and total percentage of Work completed,as of the first day of each month. D.Provide legend for symbols and abbreviations used. 3.03 BAR CHARTS A.Include a separate bar for each major portion of Work or operation. B.Identify the first work day of each week. 3.04 UPDATING SCHEDULE A.Maintain schedules to record actual start and finish dates of completed activities. B.Indicate progress of each activity to date of revision,with projected completion date of each activity. C.Annotate diagrams to graphically depict current status of Work. D.Identify activities modified since previous submittal,major changes in Work,and other identifiable changes. E.Indicate changes required to maintain Date of Substantial Completion. F.Submit reports required to support recommended changes. 3.05 DISTRIBUTION OF SCHEDULE A.Distribute copies of updated schedules to Contractor's project site file,to subcontractors,suppliers, Architect,Owner,and other concerned parties. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Construction Progress Schedule 01 32 16 - 2 B.Instruct recipients to promptly report,in writing,problems anticipated by projections indicated in schedules. END OF SECTION 01 32 16 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Quality Requirements 01 40 00 - 1 SECTION 01 40 00 QUALITY REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A.References and standards. B.Control of installation. C.Defect Assessment. 1.02 REFERENCES AND STANDARDS A.For products and workmanship specified by reference to a document or documents not included in the Project Manual,also referred to as reference standards,comply with requirements of the standard,except when more rigid requirements are specified or are required by applicable codes. B.Comply with reference standard of date of issue current on date of Contract Documents,except where a specific date is established by applicable code. C.Obtain copies of standards where required by product specification sections. D.Maintain copy at project site during submittals,planning,and progress of the specific work,until Substantial Completion. E.Should specified reference standards conflict with Contract Documents,request clarification from Architect before proceeding. F.Neither the contractual relationships,duties,or responsibilities of the parties in Contract nor those of Architect shall be altered from Contract Documents by mention or inference otherwise in any reference document. PART 3 EXECUTION 2.01 CONTROL OF INSTALLATION A.Monitor quality control over suppliers,manufacturers,products,services,site conditions,and workmanship,to produce work of specified quality. B.Comply with manufacturers'instructions,including each step in sequence. C.Should manufacturers'instructions conflict with Contract Documents,request clarification from Architect before proceeding. D.Comply with specified standards as minimum quality for the work except where more stringent tolerances,codes,or specified requirements indicate higher standards or more precise workmanship. E.Have work performed by persons qualified to produce required and specified quality. F.Verify that field measurements are as indicated on shop drawings or as instructed by the manufacturer. G.Secure products in place with positive anchorage devices designed and sized to withstand stresses,vibration,physical distortion,and disfigurement. 2.02 DEFECT ASSESSMENT A.Replace Work or portions of the Work not complying with specified requirements. END OF SECTION 01 40 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Product Requirements 01 60 00 - 1 SECTION 01 60 00 PRODUCT REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A.Transportation,handling,storage and protection. B.Product option requirements. C.Substitution limitations. D.Maintenance materials,including extra materials,spare parts,tools,and software. 1.02 REFERENCE STANDARDS A.NEMA MG 1 -Motors and Generators;2018. 1.03 SUBMITTALS A.Product Data Submittals: Submit manufacturer's standard published data. Mark each copy to identify applicable products,models,options,and other data. Supplement manufacturers' standard data to provide information specific to this Project. B.Shop Drawing Submittals: Prepared specifically for this Project;indicate utility and electrical characteristics,utility connection requirements,and location of utility outlets for service for functional equipment and appliances. C.Sample Submittals: Illustrate functional and aesthetic characteristics of the product,with integral parts and attachment devices.Coordinate sample submittals for interfacing work. 1.For selection from standard finishes,submit samples of the full range of the manufacturer's standard colors,textures,and patterns. PART 2 PRODUCTS 2.01 NEW PRODUCTS A.Provide new products unless specifically required or permitted by Contract Documents. B.Use of products having any of the following characteristics is not permitted: 1.Containing lead,cadmium,or asbestos. 2.02 PRODUCT OPTIONS A.Products Specified by Reference Standards or by Description Only: Use any product meeting those standards or description. B.Products Specified by Naming One or More Manufacturers: Use a product of one of the manufacturers named and meeting specifications,no options or substitutions allowed. C.Products Specified by Naming One or More Manufacturers with a Provision for Substitutions: Submit a request for substitution for any manufacturer not named. 2.03 MAINTENANCE MATERIALS A.Furnish extra materials,spare parts,tools,and software of types and in quantities specified in individual specification sections. B.Deliver to Project site;obtain receipt prior to final payment. PART 3 EXECUTION 3.01 SUBSTITUTION LIMITATIONS A.See Section 01 25 00 -Substitution Procedures. 3.02 TRANSPORTATION AND HANDLING A.Package products for shipment in manner to prevent damage;for equipment,package to avoid loss of factory calibration. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Product Requirements 01 60 00 - 2 B.If special precautions are required,attach instructions prominently and legibly on outside of packaging. C.Coordinate schedule of product delivery to designated prepared areas in order to minimize site storage time and potential damage to stored materials. D.Transport and handle products in accordance with manufacturer's instructions. E.Transport materials in covered trucks to prevent contamination of product and littering of surrounding areas. F.Promptly inspect shipments to ensure that products comply with requirements,quantities are correct,and products are undamaged. G.Provide equipment and personnel to handle products by methods to prevent soiling,disfigurement, or damage,and to minimize handling. H.Arrange for the return of packing materials,such as wood pallets,where economically feasible. 3.03 STORAGE AND PROTECTION A.Designate receiving/storage areas for incoming products so that they are delivered according to installation schedule and placed convenient to work area in order to minimize waste due to excessive materials handling and misapplication. See Section 01 74 19. B.Store and protect products in accordance with manufacturers'instructions. C.Store with seals and labels intact and legible. D.Store sensitive products in weathertight,climate-controlled enclosures in an environment favorable to product. E.For exterior storage of fabricated products,place on sloped supports above ground. F.Protect products from damage or deterioration due to construction operations,weather, precipitation,humidity,temperature,sunlight and ultraviolet light,dirt,dust,and other contaminants. G.Comply with manufacturer's warranty conditions,if any. H.Cover products subject to deterioration with impervious sheet covering. Provide ventilation to prevent condensation and degradation of products. I.Prevent contact with material that may cause corrosion,discoloration,or staining. J.Provide equipment and personnel to store products by methods to prevent soiling,disfigurement, or damage. K.Arrange storage of products to permit access for inspection.Periodically inspect to verify products are undamaged and are maintained in acceptable condition. END OF SECTION 01 60 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 1 SECTION 01 70 00 EXECUTION AND CLOSEOUT REQUIREMENTS PART 1 GENERAL 1.01 SECTION INCLUDES A.Examination,preparation,and general installation procedures. B.Requirements for alterations work,including selective demolition​​. C.Cutting and patching. D.Cleaning and protection. E.Starting of systems and equipment. F.Demonstration and instruction of Owner personnel. G.Closeout procedures,including Contractor's Correction Punch List,except payment procedures. H.General requirements for maintenance service. 1.02 REFERENCE STANDARDS A.NFPA 241 -Standard for Safeguarding Construction,Alteration,and Demolition Operations;2022, with Errata (2021). 1.03 SUBMITTALS A.See Section 01 30 00 -Administrative Requirements,for submittal procedures. B.Cutting and Patching: Submit written request in advance of cutting or alteration that affects: 1.Structural integrity of any element of Project. 2.Integrity of weather exposed or moisture resistant element. 3.Efficiency,maintenance,or safety of any operational element. 4.Visual qualities of sight exposed elements. 5.Work of Owner or separate Contractor. C.Project Record Documents: Accurately record actual locations of capped and active utilities. 1.04 PROJECT CONDITIONS A.Ventilate enclosed areas to assist cure of materials,to dissipate humidity,and to prevent accumulation of dust,fumes,vapors,or gases. B.Dust Control: Execute work by methods to minimize raising dust from construction operations. Provide positive means to prevent air-borne dust from dispersing into atmosphere and over adjacent property. 1.Provide dust-proof barriers between construction areas and areas continuing to be occupied by Owner. PART 2 PRODUCTS 2.01 PATCHING MATERIALS A.New Materials: As specified in product sections;match existing products and work for patching and extending work. B.Type and Quality of Existing Products: Determine by inspecting and testing products where necessary,referring to existing work as a standard. C.Product Substitution: For any proposed change in materials,submit request for substitution described in Section 01 60 00 -Product Requirements. PART 3 EXECUTION 3.01 EXAMINATION A.Verify that existing site conditions and substrate surfaces are acceptable for subsequent work. Start of work means acceptance of existing conditions. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 2 B.Verify that existing substrate is capable of structural support or attachment of new work being applied or attached. C.Examine and verify specific conditions described in individual specification sections. D.Take field measurements before confirming product orders or beginning fabrication,to minimize waste due to over-ordering or misfabrication. E.Verify that utility services are available,of the correct characteristics,and in the correct locations. F.Prior to Cutting: Examine existing conditions prior to commencing work,including elements subject to damage or movement during cutting and patching. After uncovering existing work, assess conditions affecting performance of work. Beginning of cutting or patching means acceptance of existing conditions. 3.02 PREPARATION A.Clean substrate surfaces prior to applying next material or substance. B.Seal cracks or openings of substrate prior to applying next material or substance. C.Apply manufacturer required or recommended substrate primer,sealer,or conditioner prior to applying any new material or substance in contact or bond. 3.03 GENERAL INSTALLATION REQUIREMENTS A.Install products as specified in individual sections,in accordance with manufacturer's instructions and recommendations,and so as to avoid waste due to necessity for replacement. B.Make vertical elements plumb and horizontal elements level,unless otherwise indicated. C.Install equipment and fittings plumb and level,neatly aligned with adjacent vertical and horizontal lines,unless otherwise indicated. D.Make consistent texture on surfaces,with seamless transitions,unless otherwise indicated. E.Make neat transitions between different surfaces,maintaining texture and appearance. 3.04 ALTERATIONS A.Drawings showing existing construction and utilities are based on casual field observation and existing record documents only. 1.Verify that construction and utility arrangements are as indicated. 2.Report discrepancies to Architect before disturbing existing installation. 3.Beginning of alterations work constitutes acceptance of existing conditions. B.Remove existing work as indicated and as required to accomplish new work. 1.Remove items indicated on drawings. 2.Relocate items indicated on drawings. 3.Where new surface finishes are to be applied to existing work,perform removals,patch,and prepare existing surfaces as required to receive new finish;remove existing finish if necessary for successful application of new finish. 4.Where new surface finishes are not specified or indicated,patch holes and damaged surfaces to match adjacent finished surfaces as closely as possible. C.Services (Including but not limited to HVAC,Plumbing,Fire Protection,Electrical,and Telecommunications): Remove,relocate,and extend existing systems to accommodate new construction. 1.Maintain existing active systems that are to remain in operation;maintain access to equipment and operational components;if necessary,modify installation to allow access or provide access panel. 2.Where existing systems or equipment are not active and Contract Documents require reactivation,put back into operational condition;repair supply,distribution,and equipment as required. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 3 3.Where existing active systems serve occupied facilities but are to be replaced with new services,maintain existing systems in service until new systems are complete and ready for service. a.Disable existing systems only to make switchovers and connections;minimize duration of outages. b.Provide temporary connections as required to maintain existing systems in service. 4.Verify that abandoned services serve only abandoned facilities. 5.Remove abandoned pipe,ducts,conduits,and equipment ,including those above accessible ceilings;remove back to source of supply where possible,otherwise cap stub and tag with identification;patch holes left by removal using materials specified for new construction. D.Protect existing work to remain. 1.Prevent movement of structure;provide shoring and bracing if necessary. 2.Perform cutting to accomplish removals neatly and as specified for cutting new work. 3.Repair adjacent construction and finishes damaged during removal work. E.Adapt existing work to fit new work: Make as neat and smooth transition as possible. F.Patching: Where the existing surface is not indicated to be refinished,patch to match the surface finish that existed prior to cutting. Where the surface is indicated to be refinished,patch so that the substrate is ready for the new finish. G.Refinish existing surfaces as indicated: 1.Where rooms or spaces are indicated to be refinished,refinish all visible existing surfaces to remain to the specified condition for each material,with a neat transition to adjacent finishes. 2.If mechanical or electrical work is exposed accidentally during the work,re-cover and refinish to match. H.Clean existing systems and equipment. I.Remove demolition debris and abandoned items from alterations areas and dispose of off-site;do not burn or bury. J.Do not begin new construction in alterations areas before demolition is complete. K.Comply with all other applicable requirements of this section. 3.05 CUTTING AND PATCHING A.Whenever possible,execute the work by methods that avoid cutting or patching. B.See Alterations article above for additional requirements. C.Perform whatever cutting and patching is necessary to: 1.Complete the work. 2.Fit products together to integrate with other work. 3.Provide openings for penetration of mechanical,electrical,and other services. 4.Match work that has been cut to adjacent work. 5.Repair areas adjacent to cuts to required condition. 6.Repair new work damaged by subsequent work. 7.Remove samples of installed work for testing when requested. 8.Remove and replace defective and non-complying work. D.Execute work by methods that avoid damage to other work and that will provide appropriate surfaces to receive patching and finishing. In existing work,minimize damage and restore to original condition. E.Employ original installer to perform cutting for weather exposed and moisture resistant elements, and sight exposed surfaces. F.Cut rigid materials using masonry saw or core drill. Pneumatic tools not allowed without prior approval. G.Restore work with new products in accordance with requirements of Contract Documents. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 4 H.Fit work air tight to pipes,sleeves,ducts,conduit,and other penetrations through surfaces. I.At penetrations of fire rated walls,partitions,ceiling,or floor construction,completely seal voids with fire rated material in accordance with Section 07 84 00,to full thickness of the penetrated element. J.Patching: 1.Finish patched surfaces to match finish that existed prior to patching. On continuous surfaces,refinish to nearest intersection or natural break. For an assembly,refinish entire unit. 2.Match color,texture,and appearance. 3.Repair patched surfaces that are damaged,lifted,discolored,or showing other imperfections due to patching work.If defects are due to condition of substrate,repair substrate prior to repairing finish. 3.06 PROGRESS CLEANING A.Maintain areas free of waste materials,debris,and rubbish. Maintain site in a clean and orderly condition. B.Remove debris and rubbish from pipe chases,plenums,attics,crawl spaces,and other closed or remote spaces,prior to enclosing the space. C.Broom and vacuum clean interior areas prior to start of surface finishing,and continue cleaning to eliminate dust. D.Collect and remove waste materials,debris,and trash/rubbish from site periodically and dispose off-site;do not burn or bury. 3.07 PROTECTION OF INSTALLED WORK A.Protect installed work from damage by construction operations. B.Provide special protection where specified in individual specification sections. C.Provide temporary and removable protection for installed products.Control activity in immediate work area to prevent damage. D.Provide protective coverings at walls,projections,jambs,sills,and soffits of openings. E.Protect finished floors,stairs,and other surfaces from traffic,dirt,wear,damage,or movement of heavy objects,by protecting with durable sheet materials. F.Prohibit traffic or storage upon waterproofed or roofed surfaces. If traffic or activity is necessary, obtain recommendations for protection from waterproofing or roofing material manufacturer. G.Remove protective coverings when no longer needed;reuse or recycle coverings if possible. 3.08 SYSTEM STARTUP A.Coordinate schedule for start-up of various equipment and systems. B.Verify that each piece of equipment or system has been checked for proper lubrication,drive rotation,belt tension,control sequence,and for conditions that may cause damage. C.Verify tests,meter readings,and specified electrical characteristics agree with those required by the equipment or system manufacturer. D.Verify that wiring and support components for equipment are complete and tested. E.Execute start-up under supervision of applicable Contractor personnel and manufacturer's representative in accordance with manufacturers'instructions. F.Submit a written report that equipment or system has been properly installed and is functioning correctly. 3.09 DEMONSTRATION AND INSTRUCTION A.Demonstrate start-up,operation,control,adjustment,trouble-shooting,servicing,maintenance, and shutdown of each item of equipment at scheduled time,at equipment location. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 5 B.For equipment or systems requiring seasonal operation,perform demonstration for other season within six months. C.Provide a qualified person who is knowledgeable about the Project to perform demonstration and instruction of Owner's personnel. 3.10 ADJUSTING A.Adjust operating products and equipment to ensure smooth and unhindered operation. 3.11 FINAL CLEANING A.Use cleaning materials that are nonhazardous. B.Clean interior and exterior glass,surfaces exposed to view;remove temporary labels,stains and foreign substances,polish transparent and glossy surfaces, vacuum carpeted and soft surfaces. C.Remove all labels that are not permanent. Do not paint or otherwise cover fire test labels or nameplates on mechanical and electrical equipment. D.Clean equipment and fixtures to a sanitary condition with cleaning materials appropriate to the surface and material being cleaned. E.Clean filters of operating equipment. F.Clean debris from roofs,gutters,downspouts,and area drains. G.Clean site;sweep paved areas,rake clean landscaped surfaces. H.Remove waste,surplus materials,trash/rubbish,and construction facilities from the site;dispose of in legal manner;do not burn or bury. 3.12 CLOSEOUT PROCEDURES A.Make submittals that are required by governing or other authorities. 1.Provide copies to Architect and Owner. B.Accompany Project Coordinator on preliminary inspection to determine items to be listed for completion or correction in the Contractor's Correction Punch List for Contractor's Notice of Substantial Completion. C.Notify Architect when work is considered ready for Architect's Substantial Completion inspection. D.Submit written certification containing Contractor's Correction Punch List,that Contract Documents have been reviewed,work has been inspected,and that work is complete in accordance with Contract Documents and ready for Architect's Substantial Completion inspection. E.Conduct Substantial Completion inspection and create Final Correction Punch List containing Architect's and Contractor's comprehensive list of items identified to be completed or corrected and submit to Architect. F.Correct items of work listed in Final Correction Punch List and comply with requirements for access to Owner-occupied areas. G.Notify Architect when work is considered finally complete and ready for Architect's Substantial Completion final inspection. H.Complete items of work determined by Architect listed in executed Certificate of Substantial Completion. 3.13 MAINTENANCE A.Provide service and maintenance of components indicated in specification sections. B.Maintenance Period: As indicated in specification sections or,if not indicated,not less than one year from the Date of Substantial Completion or the length of the specified warranty,whichever is longer. C.Examine system components at a frequency consistent with reliable operation. Clean,adjust,and lubricate as required. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Execution and Closeout Requirements 01 70 00 - 6 D.Include systematic examination,adjustment,and lubrication of components. Repair or replace parts whenever required. Use parts produced by the manufacturer of the original component. E.Maintenance service shall not be assigned or transferred to any agent or subcontractor without prior written consent of the Owner. END OF SECTION 01 70 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Closeout Submittals 01 78 00 - 1 SECTION 01 78 00 CLOSEOUT SUBMITTALS PART 1 GENERAL 1.01 SECTION INCLUDES A.Project record documents. B.Operation and maintenance data. C.Warranties and bonds. 1.02 RELATED REQUIREMENTS A.Section 01 30 00 -Administrative Requirements: Submittals procedures,shop drawings,product data,and samples. B.Individual Product Sections: Specific requirements for operation and maintenance data. C.Individual Product Sections: Warranties required for specific products or Work. 1.03 SUBMITTALS A.Project Record Documents: Submit documents to Architect with claim for final Application for Payment. B.Operation and Maintenance Data: 1.Submit two copies of preliminary draft or proposed formats and outlines of contents before start of Work. Architect will review draft and return one copy with comments. 2.For equipment,or component parts of equipment put into service during construction and operated by Owner,submit completed documents within ten days after acceptance. 3.Submit one copy of completed documents 15 days prior to final inspection. This copy will be reviewed and returned after final inspection,with Architect comments. Revise content of all document sets as required prior to final submission. 4.Submit two sets of revised final documents in final form within 10 days after final inspection. C.Warranties and Bonds: 1.For equipment or component parts of equipment put into service during construction with Owner's permission,submit documents within 10 days after acceptance. 2.Make other submittals within 10 days after Date of Substantial Completion,prior to final Application for Payment. 3.For items of Work for which acceptance is delayed beyond Date of Substantial Completion, submit within 10 days after acceptance,listing the date of acceptance as the beginning of the warranty period. PART 2 PRODUCTS -NOT USED PART 3 EXECUTION 3.01 PROJECT RECORD DOCUMENTS A.Maintain on site one set of the following record documents;record actual revisions to the Work: 1.Drawings. 2.Specifications. 3.Addenda. 4.Change Orders and other modifications to the Contract. 5.Reviewed shop drawings,product data,and samples. 6.Manufacturer's instruction for assembly,installation,and adjusting. B.Ensure entries are complete and accurate,enabling future reference by Owner. C.Store record documents separate from documents used for construction. D.Record information concurrent with construction progress. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Closeout Submittals 01 78 00 - 2 E.Specifications: Legibly mark and record at each product section description of actual products installed,including the following: 1.Changes made by Addenda and modifications. F.Record Drawingsand Shop Drawings: Legibly mark each item to record actual construction including: 1.Measured horizontal and vertical locations of underground utilities and appurtenances, referenced to permanent surface improvements. 2.Measured locations of internal utilities and appurtenances concealed in construction, referenced to visible and accessible features of the Work. 3.Field changes of dimension and detail. 4.Details not on original Contract drawings. 3.02 OPERATION AND MAINTENANCE DATA A.Source Data: For each product or system,list names,addresses and telephone numbers of Subcontractors and suppliers,including local source of supplies and replacement parts. B.Product Data: Mark each sheet to clearly identify specific products and component parts,and data applicable to installation. Delete inapplicable information. C.Drawings: Supplement product data to illustrate relations of component parts of equipment and systems,to show control and flow diagrams. Do not use Project Record Documents as maintenance drawings. D.Typed Text: As required to supplement product data. Provide logical sequence of instructions for each procedure,incorporating manufacturer's instructions. 3.03 OPERATION AND MAINTENANCE DATA FOR MATERIALS AND FINISHES A.For Each Product,Applied Material,and Finish: 1.Product data,with catalog number,size,composition,and color and texture designations. 2.Information for re-ordering custom manufactured products. B.Instructions for Care and Maintenance: Manufacturer's recommendations for cleaning agents and methods,precautions against detrimental cleaning agents and methods,and recommended schedule for cleaning and maintenance. C.Moisture protection and weather-exposed products: Include product data listing applicable reference standards,chemical composition,and details of installation. Provide recommendations for inspections,maintenance,and repair. D.Where additional instructions are required,beyond the manufacturer's standard printed instructions,have instructions prepared by personnel experienced in the operation and maintenance of the specific products. 3.04 OPERATION AND MAINTENANCE DATA FOR EQUIPMENT AND SYSTEMS A.For Each Item of Equipment and Each System: 1.Description of unit or system,and component parts. 2.Identify function,normal operating characteristics,and limiting conditions. 3.Include performance curves,with engineering data and tests. 4.Complete nomenclature and model number of replaceable parts. B.Where additional instructions are required,beyond the manufacturer's standard printed instructions,have instructions prepared by personnel experienced in the operation and maintenance of the specific products. C.Operating Procedures: Include start-up,break-in,and routine normal operating instructions and sequences. Include regulation,control,stopping,shut-down,and emergency instructions. Include summer,winter,and any special operating instructions. D.Maintenance Requirements: Include routine procedures and guide for preventative maintenance and trouble shooting;disassembly,repair,and reassembly instructions;and alignment,adjusting, balancing,and checking instructions. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Closeout Submittals 01 78 00 - 3 E.Provide servicing and lubrication schedule,and list of lubricants required. F.Include manufacturer's printed operation and maintenance instructions. G.Include sequence of operation by controls manufacturer. H.Provide original manufacturer's parts list,illustrations,assembly drawings,and diagrams required for maintenance. I.Provide control diagrams by controls manufacturer as installed. J.Provide charts of valve tag numbers,with location and function of each valve,keyed to flow and control diagrams. K.Provide list of original manufacturer's spare parts,current prices,and recommended quantities to be maintained in storage. L.Include test and balancing reports. M.Additional Requirements: As specified in individual product specification sections. 3.05 ASSEMBLY OF OPERATION AND MAINTENANCE MANUALS A.Assemble operation and maintenance data into durable manuals for Owner's personnel use,with data arranged in the same sequence as,and identified by,the specification sections. B.Where systems involve more than one specification section,provide separate tabbed divider for each system. C.Binders: Commercial quality,8-1/2 by 11 inch three D side ring binders with durable plastic covers;3 inch maximum ring size. When multiple binders are used,correlate data into related consistent groupings. D.Cover: Identify each binder with typed or printed title OPERATION AND MAINTENANCE INSTRUCTIONS;identify title of Project;identify subject matter of contents. E.Project Directory: Title and address of Project;names,addresses,and telephone numbers of Architect,Consultants,Contractor and subcontractors,with names of responsible parties. F.Tables of Contents: List every item separated by a divider,using the same identification as on the divider tab;where multiple volumes are required,include all volumes Tables of Contents in each volume,with the current volume clearly identified. G.Dividers: Provide tabbed dividers for each separate product and system;identify the contents on the divider tab;immediately following the divider tab include a description of product and major component parts of equipment. H.Text: Manufacturer's printed data,or typewritten data on 20 pound paper. I.Drawings: Provide with reinforced punched binder tab. Bind in with text;fold larger drawings to size of text pages. J.Provide a PDF copy,properly bookmarked as well. 3.06 WARRANTIES AND BONDS A.Obtain warranties and bonds,executed in duplicate by responsible Subcontractors,suppliers,and manufacturers,within 10 days after completion of the applicable item of work. Except for items put into use with Owner's permission,leave date of beginning of time of warranty until Date of Substantial completion is determined. B.Verify that documents are in proper form,contain full information,and are notarized. C.Co-execute submittals when required. D.Retain warranties and bonds until time specified for submittal. E.Table of Contents: Neatly typed,in the sequence of the Table of Contents of the Project Manual, with each item identified with the number and title of the specification section in which specified, and the name of product or work item. END OF SECTION 01 78 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical General Provisions 26 01 00 - 1 SECTION 26 01 00 ELECTRICAL GENERAL PROVISIONS PART 1 GENERAL 1.01 SCOPE OF WORK A.This Contractor shall provide all materials,equipment and labor necessary to install and set into operation the electrical equipment as shown on the Engineering Drawings and as contained herein. 1.02 QUALITY ASSURANCE A.See the General and Supplementary General Conditions and Architectural Divisions. B.All work shall be in accordance with the North Carolina State Building Code,which includes the 2023 edition of the National Electrical Code. C.The Contractor shall be responsible for obtaining all permits and shall notify inspection departments as work progresses. D.Wherever the words "Approved","Approval",and "Approved Equal"appear,it is intended that items other than the model numbers specified shall be subject to the approval of the Engineer. E."Provide"as used herein shall mean that the Contractor responsible shall furnish and install said item or equipment.“Furnish"as used herein shall mean that the Contractor responsible shall acquire and make available said item or equipment and that installation shall be by others. "Install" as used herein shall mean that the Contractor responsible shall make installation of items or equipment furnished by others. F.All personnel under this Contractor’s supervision shall be qualified to perform those portions of the work assigned to them. Personnel (including project managers)deemed to be negative to the overall success of the project shall be removed from the project and replaced with qualified personnel who will be positive for the project. Upon written notification that particular personnel have been deemed negative to the overall success of the project,this Contractor shall immediately replace such particular personnel. The engineer shall be sole arbiter and any decision regarding fitness of this Contractor’s personnel for this project shall not be subject to appeal. 1.03 SUBMITTALS A.See General and Supplementary General Conditions and Division 1. B.Within ten (10)days after notification of the award of the Contract and written notice to begin work, the Contractor shall submit for approval to the Architect/Engineer a detailed list of equipment and material which he proposes to use. C.The Contractor shall provide an electronic pdf copy of the submittal data on the products,methods, etc.proposed for use on the project. The submittal shall contain complete submittal data on all products,methods,etc.proposed for use on the project. D.Each submittal shall bear the approval of the Contractor indicating that he has reviewed the data and found it to meet the requirements of the specifications as well as space limitations and other project conditions. The submittals shall be clearly identified showing project name,manufacturer's catalog number and all necessary performance and fabrication data. Detailed submittal data shall be provided when items are to be considered as substitution for specified items. Acceptance for approval shall be in writing from the Engineer. E.The Contractor shall submit to the Engineer a set of accurately marked-up plans indicating all changes encountered during the construction. Final payment will be contingent on receipt of these as-built plans. F.The Contractor shall furnish an electronic copy of maintenance and operating instructions. G.The Contractor shall submit to the Engineer a duplicate set of final electrical inspection certificates prior to final payment. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical General Provisions 26 01 00 - 2 1.04 PRODUCT DELIVERY,STORAGE AND HANDLING A.All material and equipment shall be delivered and unloaded by the Contractor within the project site as noted herein or as directed by the Owner. B.The Contractor shall protect all material and equipment from breakage,theft or weather damage. No material or equipment shall be stored on the ground. C.The material and equipment shall remain the property of the Contractor until the project has been completed and turned over to the Owner. D.Where equipment cannot be stored at the site due to exposure to the elements or lack of storage space ,the contractor shall store all equipment in a bonded warehouse until the time of installation. 1.05 WORK CONDITIONS AND COORDINATION A.The Contractor shall review the entire set of plans to establish points of connection and the extent of electrical work to be provided in his Contract. B.The contractor is responsible for reviewing the complete set of contract documents.Coordinate all phasing requirements with architectural drawings.Coordinate equipment locations and utility routing with all trades to ensure code compliance and constructibility. C.This Contractor shall be responsible for all electrical work and make final connections to equipment installed in his Contract. D.Pipe,conduit and duct chases required for installation of work shall be provided by the General Contractor unless otherwise noted. This Contractor shall be responsible for coordinating the location of all required chases. E.All work shall be coordinated with other trades. Cutting of new work and subsequent patching shall be approved by Architect/Engineer and shall be at the Contractor's expense with no extra cost to the Owner. 1.06 GUARANTEE A.See the General and Supplementary General Conditions. B.Where extended warranties or guarantees are available from the manufacturer,the Contractor shall prepare the necessary Contract Documents to validate these warranties as required by the manufacturer and present them to the Architect/Engineer. PART 2 PRODUCTS 2.01 MATERIAL QUALITY A.Material and equipment shall be new,unless noted otherwise,of the highest grade and quality and free from defects or other imperfections. Material and equipment found defective shall be removed and replaced at the Contractor's expense. 2.02 EQUIPMENT LISTINGS A.All materials and equipment shall be third party listed by an agency accredited by the NCBCC and NC Department of Insurance (NC DOI).The list of accredited agencies may be obtained on NCDOI's web site. PART 3 EXECUTION 3.01 INSPECTION A.If any part of this Contractor's work is dependent for its proper execution or for its subsequent efficiency or appearance on the character or conditions of contiguous work not executed by him, the Contractor shall examine and measure such contiguous work and report to the Architect or Engineer in writing any imperfection therein,or conditions that render it unsuitable for the reception of this work. Should the Contractor proceed without making such written report,he shall be held to have accepted such work and the existing conditions and he shall be responsible for any defects in this work consequent hereon and will not be relieved of the obligation of any guarantee because of any such imperfection or condition. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical General Provisions 26 01 00 - 3 B.After the designer pre-final inspection and confirmation that the final punch list items have been completed.The contractor shall schedule a final electrical inspection with the local Inspections office. 3.02 INSTALLATION A.All work shall be performed in a manner indicating proficiency in the trade. B.All conduit,pipes,ducts,etc.,shall be either parallel to building walls or plumb where installed in a vertical position and shall be concealed when located in architecturally finished areas. C.Any cutting or patching required for installation of this Contractor's work shall be kept to a minimum. Written approval shall be required by the Architect/Engineer if cutting of primary structure is involved. D.All patching shall be done in such a manner as to restore the areas or surfaces to match existing finishes. E.The Contractor shall lay-out and install his work in advance of pouring concrete floors or walls. He shall furnish and install all sleeves or openings through poured masonry floors or walls above grade required for passage of all conduits,pipes or duct installed by him. The Contractor shall furnish and install all inserts and hangers required to support his equipment. F.The Contractor shall be responsible for removing all spray-on fireproofing overspray from all equipment,light fixtures,and all other materials provided as part of the electrical contract. 3.03 PERFORMANCE A.The Contractor shall perform all excavation and backfill operations necessary for installation of his work. B.Rock excavation shall be defined in the Supplementary General Conditions,Division 1 or Division 2. Unless specifically stated,neither rock excavation nor a unit price for rock excavation shall be required in the bid. 3.04 ERECTION A.All support steel,angles,channels,pipes or structural steel stands and anchoring devices that may be required to rigidly support or anchor material and equipment shall be provided by this Contractor. 3.05 FIELD QUALITY CONTROL A.The Contractor shall conform to the requirements of Division 3 for concrete testing. B.The Contractor shall test his entire installation and shall furnish the labor and materials required for these tests. Tests shall be performed in accordance with the requirements of the particular section of the specifications and in accordance with the requirements of the State Ordinances and Codes, and the National Electrical Code. The Contractor shall notify the Architect or Engineer of his readiness for such test. A final inspection by the Electrical Inspector or Local Authority Having Jurisdiction is required,and an inspection certificate is required prior to authorization of final payment. C.Testing required for compliance with the Contract shall be stated in subsequent sections. D.All tests specified shall be completely documented indicating time of day,date,temperature and all other pertinent test information including the entity conducting the test. E.All required documentation of readings required by each test shall be submitted to the Engineer prior to,and as one of the prerequisites for,final acceptance of the project. 3.06 ADJUST AND CLEAN A.All equipment and installed materials shall be thoroughly clean and free of all dirt,oil,grit,grease, etc. B.Factory painted equipment shall not be repainted unless damaged areas exist. These areas shall be touched up with a material suitable for the intended service. In no event shall nameplates be painted. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical General Provisions 26 01 00 - 4 C.At a scheduled meeting,the Contractor shall instruct the Owner or the Owner's representative in the operation and maintenance of all equipment installed under his Contract (in the presence of the Engineer). 3.07 MAINTENANCE AND OPERATING MANUAL A.The Contractor shall prepare an electronic submission of a manual describing the proper maintenance and system operation. This manual shall not consist of standard factory printed data intended for dimension or design purposes (although these may be included),but shall be prepared to describe this particular job. This manual shall include the following: B.Data on all equipment as listed on the fixture and equipment schedules on the plans.Also data on all equipment,components that are applicable for the project. C.Warranties as required for each product. D.A check list for periodic maintenance of all equipment requiring maintenance. E.Maintenance and spare parts data for all equipment. F.As-Built plans for installation being provided. G.The manuals shall be dated and signed by the Contractor when completed. H.The operating and maintenance manuals shall be submitted to the Engineer for approval. When the manuals are considered complete by the Engineer,they will be turned over to the Owner for their permanent use. END OF SECTION 26 01 00 26 01 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical Demolition 26 05 05 - 1 SECTION 26 05 05 ELECTRICAL DEMOLITION PART 1 GENERAL 1.01 SECTION INCLUDES A.Electrical demolition. PART 2 PRODUCTS 2.01 MATERIALS AND EQUIPMENT A.Materials and equipment for patching and extending work. PART 3 EXECUTION 3.01 EXAMINATION A.Verify field measurements and circuiting arrangements are as indicated. B.Report discrepancies to Architect before disturbing existing installation. 3.02 PREPARATION A.Disconnect electrical systems in pole lights that are being replaced. B.Coordinate any utility service outages with utility company. C.Provide temporary wiring and connections to maintain existing systems in service during construction. When work must be performed on energized equipment or circuits,use personnel experienced in such operations. D.Existing Electrical Service: Maintain existing system in service until new system is complete and ready for service. Disable system only to make switchovers and connections. Minimize outage duration. 1.Obtain permission from Owner at least 48 hours before de-energizing system. 3.03 DEMOLITION AND EXTENSION OF EXISTING ELECTRICAL WORK A.Perform work for removal and disposal of equipment and materials containing toxic substances regulated under the Federal Toxic Substances Control Act (TSCA)in accordance with applicable federal,state,and local regulations.Lamps are to be disposed of in accordance with NC G.S. 130A -310.60.Applicable equipment and materials include,but are not limited to: 1.PCB-containing electrical equipment,including transformers,capacitors,and switches. 2.PCB-and DEHP-containing lighting ballasts. 3.Mercury-containing lamps and tubes,including fluorescent lamps,high intensity discharge (HID),arc lamps,ultra-violet,high pressure sodium,mercury vapor,ignitron tubes,neon,and incandescent. B.Remove,relocate,and extend existing installations to accommodate new construction. C.Remove abandoned wiring to source of supply. D.Remove exposed abandoned conduit,including abandoned conduit above accessible ceiling finishes. Where conduit cannot be removed from floors or walls,cut conduit flush with walls and floors,and patch surfaces. E.Disconnect abandoned outlets and remove devices. Remove abandoned outlets if conduit servicing them is abandoned and removed. Provide blank cover for abandoned outlets that are not removed. F.Repair adjacent construction and finishes damaged during demolition and extension work. G.Maintain access to existing electrical installations that remain active. Modify installation or provide access panel as appropriate. H.Where existing downstream devices are to remain,extend existing branch circuit conduit and conductors to maintain service. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Electrical Demolition 26 05 05 - 2 3.04 CLEANING AND REPAIR A.Clean and repair existing materials and equipment that remain or that are to be reused. END OF SECTION 26 05 05 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Power Conductors and Cables 26 05 19 - 1 SECTION 26 05 19 POWER CONDUCTORS AND CABLES PART 1 GENERAL 1.01 SECTION INCLUDES A.Single conductor building wire. B.Underground feeder and branch-circuit cable. C.Wiring connectors. D.Electrical tape. E.Oxide inhibiting compound. F.Wire pulling lubricant. 1.02 REFERENCE STANDARDS A.ASTM B3 -Standard Specification for Soft or Annealed Copper Wire;2013 (Reapproved 2018). B.ASTM B8 -Standard Specification for Concentric-Lay-Stranded Copper Conductors,Hard, Medium-Hard,or Soft;2023. C.ASTM B33 -Standard Specification for Tin-Coated Soft or Annealed Copper Wire for Electrical Purposes;2010,with Editorial Revision (2020). D.ASTM B787/B787M -Standard Specification for 19 Wire Combination Unilay-Stranded Copper Conductors for Subsequent Insulation;2004 (Reapproved 2020). E.NFPA 70 -National Electrical Code;National Fire Protection Association,Including All Applicable Amendments and Supplements;2023. 1.03 SUBMITTALS A.Product Data: Provide manufacturer's standard catalog pages and data sheets for conductors and cables,including detailed information on materials,construction,ratings,listings,and available sizes,configurations,and stranding. B.Field Quality Control Test Reports. C.Manufacturer's Installation Instructions: Indicate application conditions and limitations of use stipulated by product testing agency.Include instructions for storage,handling,protection, examination,preparation,and installation of product. D.Project Record Documents: Record actual installed circuiting arrangements.Record actual routing of exterior below grade conduit and associated hand holes or man holes.. E.Maintenance Materials: Furnish the following for Owner's use in maintenance of project. 1.04 QUALITY ASSURANCE A.Comply with requirements of NFPA 70. B.Manufacturer Qualifications: Company specializing in manufacturing the products specified in this section with minimum five years documented experience. C.Product Listing Organization Qualifications: Third party agencies shall be amongst those accredited by the NCBCC (North Carolina Building Code Council)to label Electrical and Mechanical Equipment. 1.05 DELIVERY,STORAGE,AND HANDLING A.Receive,inspect,handle,and store conductors and cables in accordance with manufacturer's instructions. 1.06 FIELD CONDITIONS A.Do not install or otherwise handle thermoplastic-insulated conductors at temperatures lower than 14 degrees F,unless otherwise permitted by manufacturer's instructions.When installation below this temperature is unavoidable,notify Architect and obtain direction before proceeding with work. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Power Conductors and Cables 26 05 19 - 2 PART 2 PRODUCTS 2.01 CONDUCTOR AND CABLE APPLICATIONS A.Do not use conductors and cables for applications other than as permitted by NFPA 70 and product listing. B.Provide single conductor building wire installed in suitable raceway unless otherwise indicated, permitted,or required. C.Nonmetallic-sheathed cable is not permitted. 2.02 CONDUCTOR AND CABLE GENERAL REQUIREMENTS A.Provide products that comply with requirements of NFPA 70. B.Provide products listed,classified,and labeled as suitable for the purpose intended. C.All conductors shall be labeled two feet on centers indicating size,type,voltage,rating,and manufacturer's name. D.Provide new conductors and cables manufactured not more than one year prior to installation. E.Unless specifically indicated to be excluded,provide all required conduit,boxes,wiring, connectors,etc.as required for a complete operating system. F.Comply with NEMA WC 70. G.Conductor Material: 1.Provide copper conductors only!Conductor sizes indicated are based on copper. 2.Copper Conductors: Soft drawn annealed,98 percent conductivity,uncoated copper conductors. H.Minimum Conductor Size:12 AWG. I.Conductors for branch circuits shall be sized to prevent a voltage drop exceeding three percent (3%)at the farthest outlet of power,heating and lighting loads,or any combination of such loads. The maximum total voltage drop on both feeders and branch circuits to the farthest outlet shall not exceed five percent (5%). 1.Where the branch circuit conductor length from the panel to the first outlet on a 208 volt circuit exceeds 125 feet,the branch circuit conductors from the panel to the first outlet shall not be smaller than #10 AWG. Increase the branch circuit conductor size an additional wire size for reach 125’of additional length of the entire circuit. The ground conductor size shall be increased proportionately to the increase in the phase conductors per 2023 NEC 250.122(B). 2.Where the conductor length from the panel to the first outlet on a 120 volt circuit exceeds 50 feet,the branch circuit conductors from the panel to the first outlet shall not be smaller than #10 AWG. Increase the branch circuit conductor size an additional wire size for reach 100’of additional length of the entire circuit. The ground conductor size shall be increased proportionately to the increase in the phase conductors per 2023 NEC 250.122(B). J.Conductor Color Coding: 1.Color code conductors as indicated unless otherwise required by the authority having jurisdiction. Maintain consistent color coding throughout project. 2.Color Coding Method: a.Conductors #10 AWG and smaller shall be factory color coded. b.Conductors #3 and larger shall be factory color coded on the entire length. 3.Color Code: a.208Y/120 V,3 Phase,4 Wire System: 1)Phase A: Black. 2)Phase B: Red. 3)Phase C: Blue. 4)Neutral/Grounded: White. b.Equipment Ground,All Systems: Green. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Power Conductors and Cables 26 05 19 - 3 2.03 BUILDING WIRE A.Approved Manufacturers as listed below or approved equal: 1.Copper Building Wire: a.Triangle b.Okonite c.Houston Wire and Cable d.or approved equal B.Description: Single conductor insulated wire. C.Conductor Stranding: 1.Feeders and Branch Circuits: a.Size 10 AWG and Smaller: Solid. b.Size 8 AWG and Larger: Class B Stranded. D.Insulation Voltage Rating: 600 V. E.Insulation: 1.Copper Building Wire: Type THHN/THWN or XHHW-2. 2.Conductors routed on roofs or other exterior surface where raceway is exposed to direct sunlight shall be type XHHW-2 insulation. 2.04 WIRING CONNECTORS A.Description: Wiring connectors appropriate for the application,suitable for use with the conductors to be connected,and listed as complying with UL 486A-486B or UL 486C as applicable. B.Connectors for Grounding and Bonding: Comply with Section 26 05 26. C.Wiring Connectors for Splices and Taps: 1.Splices or taps shall not be allowed for feeder conductors unless specifically noted on plans. 2.Where a splice or tap for feeder conductors is noted on the plans,connectors shall be Blackburn insulated multi-tap or approved equal. 3.Splices in branch circuit conductors shall be allowed in accessible junction boxes,troughs,or gutters. a.Copper Conductors #10 AWG and smaller: Use twist-on insulated spring connectors. b.Copper Conductors #8 AWG and larger: Use mechanical connectors with gum rubber tape or friction tape.Solderless mechanical connectors with UL listed insulating covers may be used at contractor's option. 4.Use of split bolts is not allowed. 5."Sta-kon"or other permanent type crimp connectors shall not be used for branch circuit connections. D.Wiring Connectors for Terminations: 1.Provide terminal lugs for connecting conductors to equipment furnished with terminations designed for terminal lugs. 2.Provide compression adapters for connecting conductors to equipment furnished with mechanical lugs when only compression connectors are specified. 3.Where over-sized conductors are larger than the equipment terminations can accommodate, provide connectors suitable for reducing to appropriate size,but not less than required for the rating of the overcurrent protective device. E.Twist-on Insulated Spring Connectors: Rated 600 V,221 degrees F for standard applications and 302 degrees F for high temperature applications;pre-filled with sealant and listed as complying with UL 486D for damp and wet locations. 2.05 ACCESSORIES A.Electrical Tape: Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Power Conductors and Cables 26 05 19 - 4 1.Vinyl Color Coding Electrical Tape: Integrally colored to match color code indicated;listed as complying with UL 510;minimum thickness of 7 mil;resistant to abrasion,corrosion,and sunlight;suitable for continuous temperature environment up to 221 degrees F. a.Product: Okonite 2000 or approved equal. 2.Vinyl Insulating Electrical Tape: Complying with ASTM D3005 and listed as complying with UL 510;minimum thickness of 7 mil;resistant to abrasion,corrosion,and sunlight; conformable for application down to 0 degrees F and suitable for continuous temperature environment up to 221 degrees F. B.Wire Pulling Lubricant: Listed;suitable for use with the conductors or cables to be installed and suitable for use at the installation temperature. PART 3 EXECUTION 3.01 EXAMINATION A.Verify that interior of building has been protected from weather. B.Verify that work likely to damage wire and cable has been completed. C.Verify that raceways,boxes,and equipment enclosures are installed and are properly sized to accommodate conductors and cables in accordance with NFPA 70. D.Verify that field measurements are as indicated. E.Verify that conditions are satisfactory for installation prior to starting work. 3.02 PREPARATION A.Clean raceways thoroughly to remove foreign materials before installing conductors and cables. 3.03 INSTALLATION A.Circuiting Requirements: 1.Circuit routing indicated is diagrammatic. 2.Common Neutrals: Unless otherwise indicated,sharing of neutral/grounded conductors among up to three single phase branch circuits of different phases installed in the same raceway is not permitted. Provide dedicated neutral/grounded conductor for each individual branch circuit. 3.A dedicated green equipment grounding conductor shall be provided for all raceways containing branch circuit or feeder conductors.Equipment ground conductor shall be sized in accordance with the NEC. B.Install products in accordance with manufacturer's instructions. C.Install conductors and cable in a neat and workmanlike manner.Neatly train and lace wiring inside boxes,equipment,and panelboards. D.Installation in Raceway: 1.Tape ends of conductors and cables to prevent infiltration of moisture and other contaminants. 2.Pull all conductors and cables together into raceway at same time. 3.Do not damage conductors and cables or exceed manufacturer's recommended maximum pulling tension and sidewall pressure. 4.Use suitable wire pulling lubricant for conductors #4 AWG or larger,except when lubricant is not recommended by the manufacturer. E.Secure and support conductors and cables in accordance with NFPA 70 using suitable supports and methods approved by the authority having jurisdiction. Provide independent support from building structure. Do not provide support from raceways,piping,ductwork,or other systems. F.Install conductors with a minimum of 12 inches of slack at each outlet. G.Neatly train conductors inside boxes,wireways,panelboards and other equipment enclosures. Condcutors shall not be laced or bundled to avoid overheating. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Power Conductors and Cables 26 05 19 - 5 H.Group or otherwise identify neutral/grounded conductors with associated ungrounded conductors inside enclosures in accordance with NFPA 70. I.Make wiring connections using specified wiring connectors. 1.Remove appropriate amount of conductor insulation for making connections without cutting, nicking or damaging conductors. 2.Do not remove conductor strands to facilitate insertion into connector. 3.Clean contact surfaces on conductors and connectors to suitable remove corrosion,oxides, and other contaminates.Do not use wire brush on plated connector surfaces. J.Insulate ends of spare conductors using vinyl insulating electrical tape. K.Unless specifically indicated to be excluded,provide final connections to all equipment and devices,including those furnished by others,as required for a complete operating system. 3.04 FIELD QUALITY CONTROL A.All tests shall be completely documented indicating time of day,date,temperature and all pertinent test information.All required documentation shall be submitted to the Engineer prior to,and as a prerequisite for,final acceptance of the project.All test results shall be included in the Owner's operation and maintenance manual. B.Inspect and test in accordance with NETA ATS,Section 7.3.2. 1.Perform each of the following visual and electrical tests: a.Compare cable data with drawings and specifications to ensure compliance with contract documents. b.Inspect exposed sections of conductor and cable for physical damage and correct connection according to the single-line diagram. c.Test bolted connections for high resistance using one of the following: 1)A low-resistance ohmmeter. 2)Calibrated torque wrench. d.Inspect compression-applied connectors for correct cable match and indentation. e.Inspect for correct identification. f.Inspect cable jacket and condition. g.Continuity test on each conductor and cable. h.Uniform resistance of parallel conductors. C.Correct deficiencies and replace damaged or defective conductors and cables and re-test as indicated above.Contractor shall submit new test results to the Engineer to demonstrate the deficiency has been corrected. END OF SECTION 26 05 19 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 1 SECTION 26 05 33.13 CONDUIT FOR ELECTRICAL SYSTEMS PART 1 GENERAL 1.01 SECTION INCLUDES A.Galvanized steel rigid metal conduit (RMC). B.Flexible metal conduit (FMC). C.Liquidtight flexible metal conduit (LFMC). D.Electrical metallic tubing (EMT). E.Rigid polyvinyl chloride (PVC)conduit. F.Conduit fittings. G.Accessories. 1.02 REFERENCE STANDARDS A.ANSI C80.1 -American National Standard for Electrical Rigid Steel Conduit (ERSC);2020. B.ANSI C80.3 -American National Standard for Electrical Metallic Tubing --Steel (EMT-S);2020. C.ANSI C80.6 -American National Standard for Electrical Intermediate Metal Conduit;2018. D.ASTM B633 -Standard Specification for Electrodeposited Coatings of Zinc on Iron and Steel; 2023. E.ASTM A153/A153M -Standard Specification for Zinc Coating (Hot-Dip)on Iron and Steel Hardware;2023. F.ASTM A123/A123M -Standard Specification for Zinc (Hot-Dip Galvanized)Coatings on Iron and Steel Products;2017. G.NECA 101 -Standard for Installing Steel Conduits (Rigid,IMC,EMT);2020. H.NECA 111 -Standard for Installing Nonmetallic Raceways (RNC,ENT,LFNC);2017. I.NFPA 70 -National Electrical Code;National Fire Protection Association,Including All Applicable Amendments and Supplements;2023. 1.03 ADMINISTRATIVE REQUIREMENTS A.Coordination: 1.Coordinate minimum sizes of conduits with the actual conductors to be installed,including adjustments for conductor sizes increased for voltage drop. 2.Coordinate the arrangement of conduits with structural members,ductwork,piping, equipment and other potential conflicts installed under other sections or by others. 3.Verify exact conduit termination locations required for boxes,enclosures,and equipment installed under other sections or by others. 4.Coordinate the work with other trades to provide roof penetrations that preserve the integrity of the roofing system and do not void the roof warranty. 5.Notify Architect of any conflicts with or deviations from Contract Documents.Obtain direction before proceeding with work. B.Sequencing: 1.Do not begin installation of conductors and cables until installation of conduit is complete between outlet,junction and splicing points. 1.04 SUBMITTALS A.Product Data: Provide manufacturer's standard catalog pages and data sheets for conduits and fittings. B.Project Record Documents: Record actual routing for conduits installed underground exterior to the building envelope. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 2 1.05 QUALITY ASSURANCE A.Conduit shall be delivered to the project site in bundles of full length pipes,each length marked with the trademark of the manufacturer and the Underwriters'Laboratories,Inc.stamp. Each conduit length shall be straight,true and free from scales,blisters,burrs and other imperfections. 1.Product Listing Organization Qualifications: Third party agencies shall be amongst those accredited by the NCBCC (North Carolina Building Code Council)to label Electrical and Mechanical Equipment. 1.06 DELIVERY,STORAGE,AND HANDLING A.Receive,inspect,handle,and store conduit and fittings in accordance with manufacturer's instructions. PART 2 PRODUCTS 2.01 CONDUIT APPLICATIONS A.Do not use conduit and associated fittings for applications other than as permitted by NFPA 70 and product listing. B.Unless otherwise indicated and where not otherwise restricted,use the conduit types indicated for the specified applications. C.Embedded Within Concrete: 1.Within Slab on Grade: Not permitted. 2.Within Slab Above Ground: Not permitted. 3.Within Poured Concrete Walls Above Ground: Use galvanized steel rigid metal conduit, intermediate metal conduit (IMC),PVC-coated galvanized steel rigid metal conduit,rigid PVC conduit,or reinforced thermosetting resin conduit (RTRC). D.Outdoors: Apply raceways as indicated below unless otherwise noted 1.Above ground conduit: Rigid galvanized steel conduit with 90o rigid elbow below grade transition to PVC. 2.Roof:Rigid galvanized steel conduit supported on rubber blocks and unistrut frame.Conduit must be at least 3-1/2"above roof surface. 3.Feeders: PVC Type DB concrete encased 4.Branch circuits: Schedule 40 PVC direct buried 5.Telecommunications: Schedule 40 PVC concrete encased 6.Connections to vibrating equipment including transformers,generators,and other motor driven equipment: Liquid tight flexible metal conduit. 7.Boxes and enclosures above ground Nema Type 4 8.Where rigid polyvinyl (PVC)conduit is used for feeder conductors,transition to galvanized steel rigid metal conduit a minimum of three feet horizontally prior to emerging from underground. 9.Where rigid polyvinyl (PVC)conduitis used for branch circuits,use galvanized steel rigid metal conduit elbows for bends. E.Indoors: Finished spaces (not subject to physical damage) 1.Raceway shall be routed concealed in interior portions of furred spaces,ceilings,and cavities,unless other than concrete or solid plaster where possible. 2.Raceways 2 inch or less shall be allowed to be EMT conduit. 3.All raceways concealed in exterior walls shall be rigid galvanized steel conduit. 4.All raceways larger than 2 inch shall be rigid galvanized conduit. 5.Where surface mounted conduit is required in finished spaces,contractor shall utilize surface metal raceway wire mold. 6.Where there is a transition between RGS in a wall to EMT above ceiling,it shall be made at a junction box above accessible ceiling. 7.Interior,Damp or Wet Locations: Use galvanized steel rigid metal conduit. F.Stub Ups Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 3 1.All feeder stub ups shall transition below grade from PVC to rigid a minimum of 3 feet horizontally from stub up location. 2.All branch circuit stub ups,where exposed or in non-CMU walls,shall transition to rigid galvanized steel at 90 degree elbow. 3.Schedule 40 rigid polyvinyl (PVC)stub ups are only allowed where conduits come up in CMU walls or the bottom of floor mounted equipment. G.Unfinished spaces subject to damage (Electrical,Mechanical etc.) 1.All conduit in unfinished spaces shall rigid galvanized steel.Conduit is not considered subject to damage when installed at least 10 feet above finished floor or tight to structure. 2.Conduits are not required to transition to transition to rigid galvanized steel where they are routed down into panelboards or other wall mounted equipment. H.Exposed,Interior finished spaces: Use surface metal raceway as identified on the drawings. 1.Surface metal raceway shall be manufactured by Wiremold or approved equal. 2.A separate equipment ground conductor shall be run in the surface metal raceway. 2.02 CONDUIT REQUIREMENTS A.Existing Work: Where existing conduits are indicated to be reused,they may be reused only where they comply with specified requirements,are free from corrosion,and integrity is verified by pulling a mandrel through them. B.Provide all conduit,fittings,supports,and accessories required for a complete raceway system. C.Provide products listed,classified,and labeled as suitable for the purpose intended. D.Minimum Conduit Size,Unless Otherwise Indicated: 1.Interior: 3/4 inch (21 mm)trade size. 2.Exterior: 1 inch (27 mm)trade size. 2.03 GALVANIZED STEEL RIGID METAL CONDUIT (RMC) A.Manufacturers: 1.Allied Tube &Conduit. 2.Republic Conduit. 3.Wheatland Tube Company. 4.or approved equal. B.Description: NFPA 70,Type RMC standard weight mild steel,hot dipped galvanized,sherardised or zinc-coated rigid metal conduit complying with ANSI C80.1 and listed and labeled as complying with UL 6. C.Fittings: 1.Manufacturers: a.Thomas &Betts Corporation. b.Rayco. c.Appleton. d.or approved equal. 2.Connectors and Couplings: Use steel compression fittings with insulated throats. 2.04 INTERMEDIATE METAL CONDUIT (IMC) A.Description: NFPA 70,Type IMC galvanized steel intermediate metal conduit complying with ANSI C80.6 and listed and labeled as complying with UL 1242. B.Fittings: 1.Non-Hazardous Locations: Use fittings complying with NEMA FB 1 and listed and labeled as complying with UL 514B. 2.Material: Use steel or malleable iron. 3.Connectors and Couplings: Use threaded type fittings only.Threadless set screw and compression (gland)type fittings are not permitted. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 4 2.05 FLEXIBLE METAL CONDUIT AND LIQUIDTIGHT FLEXIBLE METAL CONDUIT (FMC LFMC) A.Manufacturers: 1.Allied Tube &Conduit. 2.Republic Conduit. 3.Wheatland Tube Company. 4.or approved equal. B.Description: NFPA 70,Type FMC standard wall steel flexible metal conduit listed and labeled as complying with UL 1,and listed for use in classified firestop systems to be used. C.Description: NFPA 70,Type LFMC polyvinyl chloride (PVC)jacketed steel flexible metal conduit listed and labeled as complying with UL 360. D.Spiral strip construction shall allow the conduit to bend up to four times its internal radius. E.Fittings shall be compression type with insulated throats and listed for use with conduit specified. 2.06 ELECTRICAL METALLIC TUBING (EMT) A.Manufacturers: 1.Allied Tube &Conduit. 2.Republic Conduit. 3.Wheatland Tube Company. 4.or approved equal. B.Description: NFPA 70,Type EMT cold-rolled steel electrical metallic tubing with zinc coating on the inside and protected on the inside by a zinc,enamel or equivalent corrosion-resistant coating complying with ANSI C80.3 and listed and labeled as complying with UL 797. C.Fittings: 1.Description: Fittings complying with NEMA FB 1 and listed and labeled as complying with UL 514B. 2.Material: Use steel or malleable iron. 3.Connectors and Couplings: Use hexagonal compression (gland)type. a.Do not use indenter type connectors and couplings. b.Do not use set-screw type connectors and couplings. 2.07 RIGID POLYVINYL CHLORIDE (PVC)CONDUIT A.Manufacturers: 1.Allied Tube &Conduit. 2.Republic Conduit. 3.Wheatland Tube Company. 4.or approved equal. B.Description: NFPA 70,Type PVC rigid polyvinyl chloride conduit complying with NEMA TC 2 and listed and labeled as complying with UL 651;Schedule 40 or Schedule 80 as indicated;rated for use with conductors rated 90 degrees C. C.Fittings: 1.Manufacturer: Same as manufacturer of conduit to be connected. 2.Description: Fittings complying with NEMA TC 3 and listed and labeled as complying with UL 651;material to match conduit. 2.08 ACCESSORIES A.Corrosion Protection Tape: PVC-based,minimum thickness of 20 mil. B.Conduit Joint Compound: Corrosion-resistant,electrically conductive;suitable for use with the conduit to be installed. C.Solvent Cement for PVC Conduit and Fittings: As recommended by manufacturer of conduit and fittings to be installed. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 5 D.Pull Strings:Use nylon cord with average breaking strength of not less than 200 pound-force. PART 3 EXECUTION 3.01 EXAMINATION A.Verify that field measurements are as indicated. B.Verify that mounting surfaces are ready to receive conduits. C.Verify that conditions are satisfactory for installation prior to starting work. 3.02 INSTALLATION A.Install products in accordance with manufacturer's instructions. B.Install conduit in a neat and workmanlike manner tight against walls,columns or ceilings. C.The conduit shall bend cold 90 degrees about a radius equal to ten (10)times its own diameter without signs of flaw or fracture in either pipe or protective coverings. All bends and offsets shall be made on a forming tool to prevent the conduit or its coating from being damaged in the bending. D.Install galvanized steel rigid metal conduit (RMC)in accordance with NECA 101. E.Install intermediate metal conduit (IMC)in accordance with NECA 101. F.Install rigid polyvinyl chloride (PVC)conduit in accordance with NECA 111. G.Conduit Routing: 1.Unless dimensioned,conduit routing indicated is diagrammatic. 2.Conceal all conduits unless specifically indicated to be exposed. 3.Conduits in the following areas may be exposed,unless otherwise indicated: a.Electrical rooms. b.Mechanical equipment rooms. 4.Arrange conduit to maintain maximum headroom,clearances,and access. 5.Arrange conduit to provide no more than the equivalent of four 90 degree bends between pull points. 6.Arrange conduit to provide no more than 100 feet between pull points. 7.In every instance,conduit shall be installed in such a manner that the conductors may readily and easily be drawn or pulled in without strain or damage to the insulation;and,also,so that defective conductors may be readily and easily withdrawn and replaced by new conductors. Long radius bends and a sufficient number of approved pull and junction boxes shall be approved for this purpose,and as may be directed by the Engineer. All conduit shall be securely supported and grounded. 8.Arrange conduit to prevent moisture traps.Provide drain fittings at low points and at sealing fittings where moisture may collect. 9.Where conduits join any couplings or threaded fittings,the ends shall be made watertight. 10.Maintain minimum clearance of 12 inches between conduits and hot surfaces.This includes, but is not limited to: H.Conduit Support: 1.Provide all required hangers,supports,anchors,fasteners,fittings,accessories,and hardware as necessary for the complete installation of electrical work. 2.Secure and support conduits in accordance with NFPA 70 and Section 26 05 29 using suitable supports and methods approved by the authority having jurisdiction. 3.Provide independent support from building structure.Do not provide support from piping, ductwork,or other systems. 4.Installation Above Suspended Ceilings: Do not provide support from ceiling support system. Do not provide support from ceiling grid or allow conduits to lay on ceiling tiles. 5.Use conduit strap to support single surface-mounted conduit. a.Use clamp back spacer with conduit strap for damp and wet locations to provide space between conduit and mounting surface. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 6 6.Use metal channel (strut)with accessory conduit clamps to support multiple parallel surface- mounted conduits. 7.Use conduit clamp to support single conduit from beam clamp or threaded rod. 8.Use trapeze hangers assembled from threaded rods and metal channel (strut)with accessory conduit clamps to support multiple parallel suspended conduits. 9.Steel Components: Use corrosion resistant materials suitable for the environment where installed. a.Indoor Dry Locations: Use zinc-plated steel or approved equivalent unless otherwise indicated. b.Outdoor and Damp or Wet Indoor Locations: Use galvanized steel,stainless steel,or approved equivalent unless otherwise indicated. c.Zinc-Plated Steel: Electroplated in accordance with ASTM B633. d.Galvanized Steel: Hot-dip galvanized after fabrication in accordance with ASTM A123/A123M or ASTM A153/A153M. 10.Metal Channel (Strut)Framing Systems: Factory-fabricated continuous-slot metal channel (strut)and associated fittings,accessories,and hardware required for field-assembly of supports. a.Minimum Channel Thickness: Steel sheet,12 gage,0.1046 inch. b.Minimum Channel Dimensions: 1-5/8 inch width by 13/16 inch height. I.Connections and Terminations: 1.Use approved zinc-rich paint or conduit joint compound on field-cut threads of galvanized steel conduits prior to making connections. 2.Where two threaded conduits must be joined and neither can be rotated,use three-piece couplings or split couplings.Do not use running threads. 3.Use suitable adapters where required to transition from one type of conduit to another. 4.Terminate threaded conduits in boxes and enclosures using threaded hubs or double lock nuts for dry locations and raintight hubs for wet locations. 5.Provide insulating bushings or insulated throats at all conduit terminations to protect conductors. 6.Secure joints and connections to provide maximum mechanical strength and electrical continuity. 7.Condulet fittings shall not be used in lieu of pull boxes. J.Penetrations: 1.Do not penetrate or otherwise notch or cut structural members,including footings and grade beams. 2.Make penetrations perpendicular to surfaces unless otherwise indicated. 3.Where conduits penetrate waterproof membrane,seal as required to maintain integrity of membrane. a.All raceway penetrating exterior walls or other water proof membranes shall slope away from the building with a minimum slope of 4"over 100 feet. 4.Make penetrations for roof-mounted equipment within associated equipment openings and curbs where possible to minimize roofing system penetrations.Where penetrations are necessary,seal as required to preserve integrity of roofing system and maintain roof warranty. 5.Install firestopping to preserve fire resistance rating of partitions and other elements.Refer to penetration details on plans. 6.Where conduits cross building expansion joints or pass between areas with a temperature difference of 14 degrees C,provide expansion fittings on all raceway. K.Underground Installation: 1.Minimum Cover,Unless Otherwise Indicated or Required: a.Underground,Exterior: 24 inches. 2.Provide underground warning tape six to eight inches below finished grade directly above raceway.Tape shall be six inches wide with a minimum thickness of seven mil,non- Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Conduit for Electrical Systems 26 05 33.13 - 7 distorting,colorfast,no-stretch,600 pound tensile strength per six inch width,ultraviolet light fast.Message must repeat within a maximum of 40 inches.Painted legend shall be indicative of the type of underground line. L.Condensation Prevention: Where conduits cross barriers between areas of potential substantial temperature differential,provide sealing fitting or approved sealing compound at an accessible point near the penetration to prevent condensation.This includes,but is not limited to: 1.Where conduits pass from outdoors into conditioned interior spaces. 2.Where conduits pass from unconditioned interior spaces into conditioned interior spaces. 3.Where conduits penetrate coolers or freezers. M.Provide 200 pound tensile strength pull string in all empty conduits and in conduits where conductors and cables are to be installed by others.Leave minimum slack of 12 inches at each end.All empty conduits shall terminate in a junction box. 3.03 FIELD QUALITY CONTROL A.Repair cuts and abrasions in galvanized finishes using zinc-rich paint recommended by manufacturer.Replace components that exhibit signs of corrosion. B.Correct deficiencies and replace damaged or defective conduits. 3.04 CLEANING A.Clean interior of conduits to remove moisture and foreign matter. 3.05 PROTECTION A.Immediately after installation of conduit,use suitable manufactured plugs to provide protection from entry of moisture and foreign material and do not remove until ready for installation of conductors. END OF SECTION 26 05 33.13 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Interior and Exterior Lighting 26 51 00 - 1 SECTION 26 51 00 INTERIOR AND EXTERIOR LIGHTING PART 1 GENERAL 1.01 SECTION INCLUDES A.Ballasts and drivers. B.Lamps. C.Accessories. 1.02 REFERENCE STANDARDS A.IES LM-79 -Approved Method: Optical and Electrical Measurements of Solid-State Lighting Products;2024. B.NFPA 70 -National Electrical Code;National Fire Protection Association,Including All Applicable Amendments and Supplements;2023. C.NFPA 101 -Life Safety Code;Most Recent Edition Adopted by Authority Having Jurisdiction, Including All Applicable Amendments and Supplements. D.UL 1598 -Luminaires;Current Edition,Including All Revisions. 1.03 ADMINISTRATIVE REQUIREMENTS A.Coordination: 1.Coordinate the installation of luminaires with mounting surfaces installed under other sections or by others.Coordinate the work with placement of supports,anchors,etc.required for mounting.Coordinate compatibility of luminaires and associated trims with mounting surfaces at installed locations. 2.Notify Engineer of any conflicts or deviations from Contract Documents to obtain direction prior to proceeding with work. 1.04 SUBMITTALS A.Shop Drawings: 1.Indicate dimensions and components for each luminaire that is not a standard product of the manufacturer. B.Product Data: Provide manufacturer's standard catalog pages and data sheets including detailed information on luminaire construction,dimensions,ratings,finishes,mounting requirements, listings,service conditions,photometric performance,installed accessories,and ceiling compatibility;include model number nomenclature clearly marked with all proposed features. 1.Drivers: Include wiring diagrams and list of compatible lamp configurations. 2.Lamps: Include rated life,color temperature,color rendering index (CRI),and initial and mean lumen output. C.Certificates for Dimming Drivers: Manufacturer's documentation of compatibility with dimming controls to be installed. D.Field quality control reports. E.Manufacturer's Installation Instructions: Indicate application conditions and limitations of use stipulated by product testing agency. Include instructions for storage,handling,protection, examination,preparation,and installation of product. F.Warranties. G.Operation and Maintenance Data: Instructions for each product including information on replacement parts. 1.05 QUALITY ASSURANCE A.Comply with requirements of NFPA 70. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Interior and Exterior Lighting 26 51 00 - 2 B.Maintain at the project site a copy of each referenced document that prescribes execution requirements. C.Product Listing Organization Qualifications: Third party agencies shall be amongst those accredited by the NCBCC (North Carolina Building Code Council)to label Electrical and Mechanical Equipment. 1.06 DELIVERY,STORAGE,AND PROTECTION A.Receive,handle,and store products according to manufacturer's written instructions. B.Keep products in original manufacturer's packaging and protect from damage until ready for installation. 1.07 FIELD CONDITIONS A.Maintain field conditions within manufacturer's required service conditions during and after installation. PART 2 PRODUCTS 2.01 LUMINAIRE TYPES A.Furnish products as indicated in luminaire schedule included on the drawings. 2.02 LUMINAIRES A.Provide products that comply with requirements of NFPA 70. B.Provide products that are listed and labeled as complying with UL 1598,where applicable. C.Provide products listed,classified,and labeled as suitable for the purpose intended. D.Unless otherwise indicated,provide complete luminaires including lamp(s)and all sockets, ballasts,reflectors,lenses,housings and other components required to position,energize and protect the lamp and distribute the light. E.Unless specifically indicated to be excluded,provide all required conduit,boxes,wiring, connectors,hardware,supports,trims,accessories,etc.as necessary for a complete operating system. F.Provide products suitable to withstand normal handling,installation,and service without any damage,distortion,corrosion,fading,discoloring,etc. G.LED Luminaires: 1.Components: UL 8750 recognized or listed as applicable. 2.Tested in accordance with IES LM-79 and IES LM-80. 3.Outdoor:Provide a minimum of 10 kV integral surge suppression. 4.Indoor:Provide a minimum of 2.5 kV integral surge suppression. 2.03 DRIVERS A.Drivers -General Requirements: 1.Provide ballasts containing no polychlorinated biphenyls (PCBs). 2.Minimum Efficiency/Efficacy: Provide ballasts complying with all current applicable federal and state ballast efficiency/efficacy standards. B.Dimmable LED Drivers: 1.Dimming Range: Continuous dimming from 100 percent to ten percent relative light output unless dimming capability to lower level is indicated in the fixture schedule,without flicker. 2.Control Compatibility: Fully compatible with the dimming controls to be installed.Refer to drawings. 3.Square wave inverters shall not be used with LED emergency lighting.Sinusoidal wave inverters must be used. 2.04 LAMPS A.Lamps -General Requirements: 1.Unless explicitly excluded,provide new,compatible,operable lamps in each luminaire. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Interior and Exterior Lighting 26 51 00 - 3 2.Verify compatibility of specified lamps with luminaires to be installed.Where lamps are not specified,provide lamps per luminaire manufacturer's recommendations. 3.Minimum Efficiency: Provide lamps complying with all current applicable federal and state lamp efficiency standards. 4.Color Temperature Consistency: Unless otherwise indicated,for each type of lamp furnish products which are consistent in perceived color temperature.Replace lamps that are determined by the Architect to be inconsistent in perceived color temperature. a.Unless otherwise noted on the drawings color temperatures shall be as listed below. Notify engineer if there is an inconsistency in color temperatures listed in the fixture schedule prior to ordering. 1)Exterior Lighting:4000 K 2.05 POLES A.All Poles: 1.Provide poles and associated support components suitable for the luminaire(s)and associated supports and accessories to be installed. 2.Structural Design Criteria: a.Comply with AASHTO LTS. b.Wind Load: Include effective projected area (EPA)of luminaire(s)and associated supports and accessories to be installed. 1)Design Wind Speed: ​100 miles per hour​​,with gust factor of 1.3.​ c.Dead Load: Include weight of proposed luminaire(s)and associated supports and accessories. d.Include structural calculations demonstrating compliance with submittals. 3.Material: Aluminum,unless otherwise indicated. 4.Shape: As indicated in the fixture schedule. 5.Mounting Height: As indicated in the fixture schedule. 6.Mounting: Install on concrete foundation,height as indicated on the drawings,unless otherwise indicated. 7.Unless otherwise indicated,provide with the following features/accessories: a.Top cap. b.Handhole. c.Anchor bolts with leveling nuts or leveling shims. B.Metal Poles: Provide ground lug,accessible from handhole. PART 3 EXECUTION 3.01 EXAMINATION A.Verify that field measurements are as indicated. B.Verify that outlet boxes are installed in proper locations and at proper mounting heights and are properly sized to accommodate conductors in accordance with NFPA 70. C.Verify that suitable support frames are installed where required. D.Verify that branch circuit wiring installation is completed,tested,and ready for connection to luminaires. E.Verify that conditions are satisfactory for installation prior to starting work. 3.02 PREPARATION A.Provide extension rings to bring outlet boxes flush with finished surface. B.Clean dirt,debris,plaster,and other foreign materials from outlet boxes. 3.03 INSTALLATION A.Coordinate locations of outlet boxes provided under Section 26 05 33.16 as required for installation of luminaires provided under this section. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County Emergency Services -Lighting PDC Project 24029 Interior and Exterior Lighting 26 51 00 - 4 B.All luminaire surge suppression shall be evaluated and tested in accordance with ANSI C62.41.2 standard. C.Install products in accordance with manufacturer's instructions. D.Provide required support and attachment in accordance with Section 26 05 29. E.Install luminaires securely,in a neat and workmanlike manner. F.Pole-Mounted Luminaires: 1.Maintain the following minimum clearances: 2.Foundation-Mounted Poles: a.Provide cast-in-place concrete foundations for poles as indicated. 1)Install anchor bolts plumb per template furnished by pole manufacturer. 2)Position conduits to enter pole shaft. b.Install foundations plumb. c.Install poles plumb,using leveling nuts or shims as required to adjust to plumb. d.Tighten anchor bolt nuts to manufacturer's recommended torque. e.Install non-shrink grout between pole anchor base and concrete foundation,leaving small channel for condensation drainage. f.Install anchor base covers or anchor bolt covers as indicated. 3.Grounding: a.Bond luminaires,metal accessories,metal poles,and foundation reinforcement to branch circuit equipment grounding conductor. G.Install accessories furnished with each luminaire. H.Bond products and metal accessories to branch circuit equipment grounding conductor. I.Install lamps in each luminaire. J.Lamp Burn-In: Operate lamps at full output for prescribed period per manufacturer's recommendations prior to use with any dimming controls.Replace lamps that fail prematurely due to improper lamp burn-in. 3.04 FIELD QUALITY CONTROL A.Inspect each product for damage and defects. B.Operate each luminaire after installation and connection to verify proper operation. C.Correct wiring deficiencies and repair or replace damaged or defective products.Repair or replace excessively noisy ballasts as determined by Architect. 3.05 ADJUSTING A.Aim and position adjustable luminaires to achieve desired illumination as indicated or as directed by Architect.Secure locking fittings in place. 3.06 CLEANING A.Clean surfaces according to manufacturer's instructions to remove dirt,fingerprints,paint,or other foreign material and restore finishes to match original factory finish. 3.07 CLOSEOUT ACTIVITIES A.Demonstration: Demonstrate proper operation of luminaires to Architect,and correct deficiencies or make adjustments as directed. B.After the designer final inspection prior to local AHJ inspection and final acceptance replace all lamps that have failed and clean all lenses. 3.08 PROTECTION A.Protect installed luminaires from subsequent construction operations. END OF SECTION 26 51 00 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 PROJECT:PROJECT LOCATION:INDEX OF DRAWINGS:OWNER:THESE DRAWINGS ARE INSTRUMENTS OF SERVICE AND AS SUCH SHALL REMAIN THE PROPERTY OF PROGRESSIVE DESIGN COLLABORATIVE, LTD. THEY SHALL NOT BE USED FOR ANY OTHER WORK OTHER THAN THAT AUTHORIZED BY PROGRESSIVE DESIGN COLLABORATIVE, LTD. UPON COMPLETION OF THE WORK, ALL COPIES, EXCEPT THE OWNER'S, SHALL BE RETURNED TO PROGRESSIVE DESIGN COLLABORATIVE, LTD.PASSMORE SENIOR CENTER EXTERIOR LIGHTINGPASSMORE SENIOR CENTER101 Meadowlands Dr.Hillsborough, NC 27278ORANGE COUNTY306 Revere Road, A102Hillsborough, NC 27278PDC# 25015G0.01VICINITYCAMPUSSHEET INDEXSheet Number Sheet NameG0.01 COVER SHEETE0.00 ELECTRICAL LEAD SHEETE1.01 LIGHTING PLANE1.02 PHOTOMETRICSE1.03 SPECIFICATIONSDocusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ABBREVIATIONSABBREV.AACA/CADAAFFAFGAICALANSIATSCATSA/VAWGBASBFCCCBCCTVCKTCTCUDDBDCDLDISCEECBEWCEXFUTFAFACPFATCFDRGAAGAPGENGECGFIGFCIGFEPGFPGNDGRSHHHOAHPIEEEIGKCMILKVKVAKWKWHLCLSLSIGMAXMCBMCCMDPMINMHMLOMTSN/ANCNECNEMAN or NEUTNFPANICNOO/HPPAPBPCPHPTRCRSCSECSPDSWSWBDSWGRTCTEMPTGBTGMBTTBTVTYP.U/CU/GUGEULUONUPSVVFDWGWPXFERXFMRDEFINITIONAMPS, AMPERE, AMPERAGEABOVE COUNTERALTERNATING CURRENTAMERICANS WITH DISABILITIES ACTABOVE FINISHED FLOORABOVE FINISHED GRADEAMPERE INTERRUPTING CURRENTALUMINUMAMERICAN NATIONAL STANDARD INSTITUTEAUTOMATIC TRANSFER SWITCH CONTROLAUTOMATIC TRANSFER SWITCHAUDIO/VISUALAMERICAN WIRE GAUGEBUILDING AUOTMATION SYSTEMBELOW FINISHED CEILINGCONDUITCIRCUIT BREAKERCLOSED CIRCUIT TELEVISIONCIRCUITCURRENT TRANSFORMERCOPPERDIMMING OR DIMMERDISTRIBUTION BOARDDIRECT CURRENTDAY-LIGHTINGDISCONNECT SWITCHEMERGENCYENCLOSED CIRCUIT BREAKERELECTRIC WATER COOLEREXISTINGFUTUREFIRE ALARMFIRE ALARM CONTROL PANELFIRE ALARM TERMINAL CABINETFEEDERGENERATOR ALARM ANNUNCIATORGENERATOR ALARM PANELGENERATORGROUNDING ELECTRODE CONDUCTORGROUND FAULT INTERRUPTERGROUND FAULT CIRCUIT INTERRUPTERGROUND FAULT EQUIPMENT PROTECTIONGROUND FAULT PROTECTIONGROUNDGALVANIZED RIGID STEELHAND HOLEHAND-OFF AUTOMATICHORSEPOWERINSTITUE OF ELECTRICAL AND ELECTRONICS ENGINEERSISOLATED GROUNDTHOUSAND CIRCULAR MILSKILOVOLTKILOVOLT AMPSKILOWATTKILOWATT HOURSLIGHTING CONTACTORLOUD SPEAKERLONG TIME, SHORT TIME, INSTANTANEOUS AND GROUND FAULT PROTECTIONMAXIMUMMAIN CIRCUIT BREAKERMOTOR CONTROL CENTERMAIN DISTRIBUTION PANELMINIMUMMAN HOLEMAIN LUGS ONLYMANUAL TRANSFER SWITCHNOT APPLICABLENORMALLY CLOSEDNATIONAL ELECTRIC CODENATIONAL ELECTRICAL MANUFACTURER'S ASSOCIATIONNEUTRALNATIONAL FIRE PROTECTION ASSOCIATIONNOT IN CONTRACTNORMALLY OPENOVER HEADPOLEPUBLIC ADDRESSPULL BOXPHOTOCELLPHASE POTENTIAL TRANSFORMERPOTENTIAL TRANSFORMERRECEPTACLE CONTACTORRIGID STEEL CONDUITSECURITYSURGE PROTECTIVE DEVICESWITCHSWITCHBOARDSWITCHGEARTIME CLOCKTEMPORARYTECHNOLOGY GROUND BARTECHNOLOGY MAIN GROUND BARTELEPHONE TERMINAL BOARDTELEVISIONTYPICALUNDER COUNTERUNDERGROUNDUNDERGROUND ELECTRICUNDERWRITERS' LABORATORIESUNLESS OTHERWISE NOTEDUNINTERRUPTABLE POWER SUPPLYVOLTS, VOLTAGEVARIABLE FREQUENCY DRIVEWIRE GUARDWEATHERPROOFTRANSFERTRANSFORMERGENERAL NOTESA. THE ELECTRICAL CONTRACTOR SHALL COORDINATE ANY AND ALL WORK WITH OTHER TRADES INVOLVED IN THE PROJECT, PRIOR TO THE INSTALLATION OF HIS EQUIPMENT SO AS TO AVOID CONFLICTS DURING CONSTRUCTION AND ALLOW FOR OPTIMUM MAINTENANCE AND WORKING SPACE.B. ALL WORK AND MATERIAL SHALL BE PROVIDED IN ACCORDANCE WITH STATE, LOCAL AND NATIONAL CODES AND ORDINANCES.C. EACH CONTRACTOR SHALL PROVIDE HIS OWN SUPPORT OF ALL DEVICES AND EQUIPMENT PROVIDED BY HIM AND SHALL SUPPORT SUCH EQUIPMENT PER APPROVED GOVERNING CODES OR PER APPROVAL OF THE ENGINEER. UNACCEPTABLE WORKMANSHIP OR MATERIALS SHALL BE REPLACED AT THE REQUEST OF THE ENGINEER AT THE CONTRACTOR'S EXPENSE.D. ALL WIRE AND CONDUIT SIZES ARE BASED ON 75°C THHN OR THWN WIRE UNLESS OTHERWISE NOTED.E. WHERE ELECTRICAL EQUIPMENT PENETRATES EXTERIOR WALLS OR THE ROOF, THEY SHALL BE PROPERLY SEALED WITH METHODS APPROVED BY THE ENGINEER. SUBMIT DETAIL OF PROPOSED SEALING METHODS.F. CONDUCTORS FOR BRANCH CIRCUITS SHALL BE SIZED TO PREVENT VOLTAGE DROP EXCEEDING 3% AT THE FARTHEST OUTLET OF POWER, HEATING AND LIGHTING LOADS, OR ANY COMBINATION OF SUCH LOADS. THE MAXIMUM TOTAL VOLTAGE DROP ON BOTH FEEDERS AND BRANCH CIRCUITS TO THE FARTHEST OUTLET SHALL NOT EXCEED 5%.1. WHERE THE CONDUCTOR LENGTH FROM THE PANEL TO THE FIRST OUTLET ON A 120V CIRCUIT EXCEED 50'-0" THE BRANCH CIRCUIT CONDUCTORS FROM THE PANEL TO THE FIRST OUTLET SHALL NOT BE SMALLER THAN #10AWG. INCREASE THE BRANCH CIRCUIT CONDUCTOR SIZE AN ADDITIONAL WIRE SIZE FOR EACH ADDITIONAL 125' FOR THE ENTIRE CIRCUIT. THE GROUND CONDUCTOR SIZE SHALL BE INCREASED PROPORTIONALLY TO THE INCREASED PHASE CONDUCTORS AS PER NEC 2020 250.122 (B).2. WHERE THE CONDUCTOR LENGTH FROM THE PANEL TO THE FIRST OUTLET ON A 277V CIRCUIT EXCEEDS 125'-0", THE BRANCH CIRCUIT CONDUCTORS FROM THE PANEL TO THE FIRST OUTLET SHALL NOT BE SMALLER THAN #10 AWG. CONDUCTOR SIZE OF REMAINING BRANCH CIRCUIT SHALL INCREASE AS NEEDED TO MEET ABOVE VOLTAGE DROP LIMITATIONS. THE GROUND CONDUCTOR SIZE SHALL BE INCREASED PROPORTIONALLY TO THE INCREASED PHASE CONDUCTORS AS PER NEC 2020 250.122(B).G. ELECTRICAL CONTRACTOR SHALL VISIT SITE PRIOR TO BID. SYMBOL LEGENDDESCRIPTIONREMARKSHOME RUN CIRCUIT TO PANELBOARDSYMBOLEXISTING 120/208 VOLT PANELBOARD WITH NEUTRAL AND GROUND BUSEXISTING 277/480 VOLT PANELBOARD WITH NEUTRAL AND GROUND BUSFLOODLIGHT LUMINAIREMETHOD OF COMPLIANCE:ELECTRICAL SYSTEM AND EQUIPMENTPRESCRIPTIVE__X__ PERFORMANCE_____LIGHTING SCHEDULETotal wattage per fixture - Varies - See Fixture ScheduleNumber of ballasts in fixture - See Specifications.Ballast type used in the fixture - See Specifications.Number of lamps in fixture - See Fixture Schedule.Lamp type required in fixture - See Fixture Schedule.To the best of my knowledge and belief, the design of this building complies with the electrical system and equipment requirements of the 2018 North Carolina State Building Code, Energy Conservation Code.DESIGNER STATEMENT:___ 406.6 Provision of Dedicated Outdoor HVAC Air System___ 406.5 On-Site Supply of Renewable Energy___ 406.4 Enhanced Lighting Controls___ 406.3 Reduced Lighting Power Density___ 406.2 More Efficient HVAC PerformanceADDITIONAL PRESCRIPTIVE COMPLIANCETotal exterior wattage specified versus allowed: 1250 watts versus 1930 watts (Partial Exterior)Total interior wattage specified versus allowed: N/A watts versus N/A watts ENERGY CODE:PRESCRIPTIVE_____ PERFORMANCE_____ASHRAE 90.1:___ 406.7 High Efficiency Service Water HeatingXLOAD SUMMARY: EX.PNL.LP31.5 KVA1.5 x 10001.8 AMPSI =480 x =1.25 KVA3TOTAL DIVERSITYCONNECTED KVA DEMAND KVA0 x 1.00 x 0.5{ }1.250000LIGHTINGHVACPOWERKITCHEN EQUIPMENTRECEPTACLES1.50000x1.25x1.0x1.0x1.0SHEET INDEX - ELECTRICALSheet Number Sheet Name Current Revision Current Revision DateE0.00 ELECTRICAL LEAD SHEETE1.01 LIGHTING PLANE1.02 PHOTOMETRICSE1.03 SPECIFICATIONSDRAWN BY:CHECKED BY:REVISIONSTBUTKOVICH@PDCENGINEERS.COMPASSMORE SENIOR CENTER EXTERIORLIGHTINGELECTRICALLEAD SHEETE0.00PERMIT SETORANGE COUNTYTMCJTBPDC 2501506/20/2024NUMBER DATE DESCRIPTION06/19/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 EX.LP3EX.RP4EX.MP1EX.SDP2EX.T3(225KVA)EX.800A E.C.B.EX.PP2EX.RP5EX.RP7EX.225A E.C.B.EX.3W-MTSA1A1A1A1A1A1AAAA132MARK SIZEMOUNTINGVOLTMANUFACTURER AND MODEL NO.EQUALSDESCRIPTIONLAMPWATTSMTG. HGT.A 17'L X 12"HTRUNNION277COOPER # NHRS50UTLITHONIA, EATONLED FLOODLIGHT LUMINAIRE, ADJUSTABLE WATTAGE (40W-155W) AND ADJUSTABLE CCT (3000K, 4000K, 5000K)4000K LED 13,700 LUMENS100W 10'A1 17'L X 12"H TRUNNION 277 COOPER # NHRS50UT LITHONIA, EATONLED FLOODLIGHT LUMINAIRE, ADJUSTABLE WATTAGE (40W-155W) AND ADJUSTABLE CCT (3000K, 4000K, 5000K)4000K LED 22,000 LUMENS150W 16'LIGHTING FIXTURE SCHEDULEDRAWN BY:CHECKED BY:REVISIONSTBUTKOVICH@PDCENGINEERS.COMKEYPLANNOT TO SCALEPASSMORE SENIOR CENTER EXTERIORLIGHTINGLIGHTING PLANE1.01PERMIT SETORANGE COUNTYTMC JTBPDC 2501506/20/2024GENERAL NOTES:A. REFER TO ELECTRICAL LEAD SHEET E0.00 FOR SYMBOLS, ABBREVIATIONS AND NOTES.B. THE ELECTRICAL CONTRACTOR SHALL COORDINATE ANY AND ALL WORK WITH OWNER, PRIOR TO INSTALLATION OF THE NEW EQUIPMENT, SO TO AVOID CONFLICTS DURING CONSTRUCTION AND TO ALLOW FOR OPTIMUM MAINTENANCE AND WORKING SPACE.C. CONDUIT/WIRE ROUTING SHOWN IS FOR INFORMATIONAL PURPOSES ONLY, FOR THE CLARIFICATION OF SCOPE. EXACT EXISTING ROUTING OR NEW INSTALLATION SHALL BE FIELD VERIFIED.D. CONDUIT TO BE CONCEALED. EXPOSED CONDUIT ON BUILDING IS NOT ACCEPTABLE.E. LIGHT FIXTURES TO BE CONNECTED TO EXISTING EXTERIOR LIGHTING CONTROL SYSTEM.KEYNOTES:04' 8'16'1/8" = 1'-0"EXTERIOR LIGHTING11. CONNECT FIXTURES TO EXTERIOR LIGHTING CIRCUIT IN PANEL LP3 AND TO THE EXISTING EXTERIOR LIGHTING CONTROL CIRCUIT USING 2 #10, 1 #10G IN 3/4" C.2. FIXTURE HEIGHT TO MATCH EXISTING WINDOW SUNSCREEN HEIGHT THIS AREA (APPROXIMATELY 10'-0" AFF) VERIFY IN FIELD.3. FIXTURES THIS AREA TO BE PLACED AT HEIGHT DIRECTLY BELOW SECOND STORY WINDOW SUNSHADES (APPROXIMATELY 16'-0" AFF) VERIFY IN FIELD.NUMBER DATE DESCRIPTION06/19/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 FEC-1FECRLORLRLORLORLRLRLRLREFRIG.(N.I.C.)NEW EXISTINGExistingActivityRoomRoomExistingActivityRoomExistingGame AreaExistingBallroomExistingActivityRoomProposedLandscapeArea0.10.10.10.10.10.10.20.40.10.10.20.40.92.74.10.10.10.10.20.41.36.116.720.78.60.10.10.20.30.51.15.120.842.948.30.10.10.20.30.82.75.98.925.70.10.10.20.30.84.014.724.516.00.10.10.20.30.62.513.736.553.50.10.20.20.40.82.25.317.744.60.10.20.30.40.93.712.415.312.50.20.40.50.82.713.935.040.70.30.50.91.42.16.625.754.20.30.51.12.64.67.210.619.50.30.51.12.97.314.626.329.10.20.40.82.36.815.934.358.666.90.40.71.65.013.327.254.20.30.51.03.19.923.038.856.60.40.71.75.716.433.248.353.60.51.13.19.722.840.754.00.71.75.616.131.447.50.51.02.89.624.642.755.90.61.54.815.133.051.659.70.82.38.022.742.760.41.13.412.131.355.671.30.61.44.816.136.560.972.10.71.86.519.940.460.40.82.38.524.044.460.30.92.910.226.146.359.30.51.13.612.328.447.449.00.51.24.515.434.152.30.51.45.317.437.154.40.51.45.416.934.551.70.20.51.35.115.330.745.00.00.00.00.00.00.00.00.085.3EX.LP3EX.RP4EX.MP1EX.SDP2EX.T3(225KVA)EX.800A E.C.B.EX.PP2EX.RP5EX.RP7EX.225A E.C.B.EX.3W-MTSA1A1A1A1A1A1AAAADRAWN BY:CHECKED BY:REVISIONSTBUTKOVICH@PDCENGINEERS.COMKEYPLANNOT TO SCALEPASSMORE SENIOR CENTER EXTERIORLIGHTINGPHOTOMETRICSE1.02PERMIT SETORANGE COUNTYTMC JTBPDC 2501506/20/2024GENERAL NOTES:A. REFER TO ELECTRICAL LEAD SHEET E0.00 FOR SYMBOLS, ABBREVIATIONS AND NOTES.B. PHOTOMETRIC LEVELS ARE VARIABLE FOR THE SPECIFIED FIXTURES. ACTUAL LEVELS TO BE ADJUSTED AS NECESSARY ON SITE.04' 8' 16'1/8" = 1'-0"PHOTOMETRICS PLAN1NUMBER DATE DESCRIPTION06/19/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 DRAWN BY:CHECKED BY:REVISIONSTBUTKOVICH@PDCENGINEERS.COMPASSMORE SENIOR CENTER EXTERIORLIGHTINGSPECIFICATIONSE1.03PERMIT SETORANGE COUNTYTMC JTBPDC 2501506/20/2024NUMBER DATE DESCRIPTION06/19/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Finance and Administrative Services Department – Purchasing Division ITB Addendum No. 1 March 20, 2026 ORANGE COUNTY ITB No 367-OC5474 Orange County Exterior Lighting Improvements This Addendum shall be included in the contract for the above-referenced project. All General, Supplementary, and Special Conditions, etc., as originally specified or as modified below, shall apply to these items. General 1. Contractors may submit their substitution request to Orange County (Abarnes@orangecountync.gov) no later than March 24, 2026. Orange County will respond with approval or rejection of the substitution by March 27th, 2026. Attachments: ITB 367-OC5474 Exterior Lighting Upgrades for Jerry M Passmore Center & Emergency Services Center Prebid Meeting Minutes ITB 367-OC5474 Exterior Lighting Upgrades for Jerry M Passmore Center & Emergency Services Center Prebid Meeting Sign-In Sheet End of Addendum 1 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County, NC Orange County Exterior Lighting Upgrades for Jerry M. Passmore Center & Emergency Services Center RFP – 367-OC5474 Pre-Bid Conference Agenda March 12, 2026, at 10:00 a.m. Owner: Orange County 306 Revere Road Hillsborough, NC 27278 Location: 103 Meadowlands Drive and 510 Meadowlands Drive Hillsborough, NC 27278 Engineer: Progressive Design Collaborative, Ltd. 3101 Poplarwood Court, Suite 320 Raleigh, NC 27604 On behalf of the Owner and PDC, we would like to thank you for your interest and attendance at this Pre-Bid Conference. As this is a NON-Mandatory Prebid, we still request that everyone sign in for the record. I. Bid: Bids will be received until 2:00 P.M. on Tuesday, March 31st, 2026, for a Single Prime Contract at: Transmit bids via email to Orange County Finance Manager – Purchasing at financing- purchasing@orangecountync.gov II. Bid Day Documents: Refer to Bid Package – Ensure all documents are signed, sealed, and attested (or witnessed) as required. 1. Contractor’s Completed and Signed Bid Form 2. Living Wage Contractor Policy 3. E-Verify Affidavit 4. Supplemental Vendor Information: Historically Underutilized Businesses 5. Minority Business Participation forms – Affidavit A or B Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County, NC III. Base Bid A. Base Bid 1: Jerry M. Passmore Exterior Lighting State the amount for the Base Bid for all labor and materials required to accomplish the work involved per the plans and specifications. B. Base Bid 2: Emergency Services Exterior Lighting Upgrade State the amount for the Base Bid for all labor and materials required to accomplish the work involved per the plans and specifications. IV. Alternates There are no alternates for this project. V. E-Procurement Vendors: E-Procurement rules WILL apply for Registered E-Procurement Vendors only. If the low bidder is an E-Procurement Vendor, the owner will not be responsible for any fees associated with the E- Procurement process incurred by the low bidder or any subcontractor, as specified in paragraphs below: REGISTERED E-PROCUREMENT VENDORS: 1. ELECTRONIC PROCUREMENT (APPLIES TO ALL CONTRACTS THAT INCLUDE E- PROCUREMENT AND ARE IDENTIFIED AS SUCH IN THE BODY OF THE SOLICITATION DOCUMENT): Purchasing shall be conducted through the Statewide E- Procurement Service. The State’s third-party agent shall serve as the Supplier Manager for this E- Procurement Service. THE SUCCESSFUL BIDDER (S) SHALL PAY A TRANSACTION FEE OF 1.75% (.0175) ON THE TOTAL DOLLAR AMOUNT (EXCLUDING SALES TAXES) OF EACH PURCHASE ORDER ISSUED THROUGH THE STATEWIDE E-PROCUREMENT SERVICE. This applies to all purchase orders, regardless of the quantity or dollar amount of the purchase order. The transaction fee shall not be stated or included as a separate item in the proposed contract or invoice. There are no additional fees or charges to the contractor for the services rendered by the Supplier Manager under this contract. Contractor will receive a credit for transaction fees they paid for the purchase of any item(s) if an item(s) is returned through no fault of the contractor. Transaction fees are non-refundable when an item is rejected and returned, or declined, due to the contractor’s failure to perform or comply with specifications or requirements of the contract. Contractor or its Authorized Reseller, as applicable, will be invoiced monthly for the State’s transaction fee by the Supplier Manager. The transaction fee shall be based on purchase orders issued for the prior month. Unless Supplier Manager receives written notice from the Contractor identifying with specificity any errors in an invoice within thirty (30) days of the receipt of invoice, such invoice shall be deemed to be correct and Contractor shall have waived its right to later dispute the accuracy and completeness of the invoice. Payment of the transaction fee by the Contractor is due to the account designated by the State within thirty (30) days after receipt of the correct invoice for the transaction fee, which includes payment of all portions of an invoice not in dispute. Within thirty (30) days of the receipt of invoice, contractor may request in writing an extension of the invoice payment due date for that portion of the transaction fee invoice for Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County, NC which payment of the related goods by the governmental purchasing entity has not been received by the Contractor. If payment of the transaction fee is not received by the State within this payment period, it shall be considered a material breach of contract. The Supplie r Manager shall provide, whenever reasonably requested by the contractor in writing (including electronic documents), supporting documentation from the E-Procurement Service that accounts for the amount of the invoice. The Supplier Manager will capture the order from the State approved user, including the shipping and payment information, and submit the order in accordance with the E - Procurement Service. Subsequently, the Supplier Manager will send those orders to the appropriate contractor on State Contract. The State or State approved user, not the Supplier Manager, shall be responsible for the solicitation, bids received, evaluation of bids received, award of contract, and the payment for goods delivered. Contractor agrees at all times to maintain the confidentiality of its user name and password for the Statewide E- Procurement Services. If a contractor is a corporation, partnership or other legal entity, then the contractor may authorize its employees to use its password. Contractor shall be responsible for all activity and all charges by such employees. Contractor agrees not to permit a third party to use the Statewide E -Procurement Services through its account. If there is a breach of security through the contractor’s account, contractor shall immediately change its password and notify the Supplier Manager of the security breach by e-mail. Contractor shall cooperate with the State and the Supplier Manager to mitigate and correct any security breach. 2. NON-REGISTERED E-PROCUREMENT VENDORS: E-Procurement Rules DO NOT apply. VI. Schedule: Notice to Proceed: Anticipated April 14, 2026. Substantial Completion: November 20, 2026 (Approx 220 Calendar Days) Final Completion: Shall occur 30 days after Substantial Completion VII. Examination of Bid Documents: All Bidders are expected to fully examine and familiarize themselves with the Drawings, Specifications, and Existing Conditions. All Bidders should read the scope of the bid package. Any questions or clarifications should be directed to the Orange County Capital Projects Manager. No allowances will be made after the bids are received for any oversight due to failure to examine the documents. VIII. Substitutions Substitutions or approvals of “Equals” will only be accepted is approved by the Engineer in writing at least 8 days prior to the receipt of bids: March 23rd, 2026. IX. Technical Questions: Technical questions should be submitted to the Orange County Capital Projects Manager as soon as possible, preferably by email. Angel Barnes (Orange County Capital Projects Manager) abarnes@orangecountync.gov (919) 610–8182 X. Construction Documents: This is an informal bid, and construction documents and specifications are available in PDF format on the Orange County Website. All addenda will be posted to the Orange County website under the purchase website. https://www.orangecountync.gov/Bids.aspx If you have any issues or cannot download any of the Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Orange County, NC documents, please let the Orange County Capital Projects Manager know, and she will work to make sure we get them to you. XI. Addenda: Addenda will be posted to the website @ https://www.orangecountync.gov/Bids.aspx. Contractors are encouraged to sign up for notifications on this site to receive email or text alerts when documents are posted. XII. Brief Description of the project: This project consists of exterior lighting upgrades at two Orange County Facilities. The first facility is the Jerry M. Passmore Center. This work consists of installing exterior lighting along the front of the Jerry M. Passmore Center. The second facility is the Orange County Emergency Services Facility, which consists of replacing the exterior lighting and poles. Bids will be received from contractors for Single Prime. All proposals shall be lump sum. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Finance and Administrative Services Department – Purchasing Division ITB Addendum No. 2 March 24, 2026 ORANGE COUNTY ITB No 367-OC5474 Orange County Exterior Lighting Improvements This Addendum shall be included in the contract for the above-referenced project. All General, Supplementary, and Special Conditions, etc., as originally specified or as modified below, shall apply to these items. General The attached package reflects the approval or rejection of alternates received. Attachments: ITB 367-OC5474 Exterior Lighting Upgrades for Jerry M Passmore Center & Emergency Services Center Alternates End of Addendum 2 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ORANGE COUNTY BID NO. 367-OC5474 Mar 13 2026 Project Number 367-OC5474 FINANCE AND ADMINISTRATIVE SERVICES HILLSBOROUGH, NC 27278, USA - Prepared By - Ash K. - IKIO LED Lighting +1 463- 426-5939 ashk@ikioledlighting.com 8470 Allison Pointe Blvd Indianapolis, IN 46250, USA Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ORANGE COUNTY BID NO. 367-OC5474 Project Number 367-OC5474 Table of Contents Datasheets Manufacturer Model Number & Description Pg. IKIO IK-TFFL-150W-30/40/50K-MV-DBR 2 IKIO IK-SAL-140W-3CCT-LV-T3-BL 4 IKIO IK-SS-25FT4-11G-D-T (BLACK)9 ACCEPTED FOR USE FOR ALL FIXTURES REJECTED REJECTED TMC 3/23/26 X PROGRESSIVE DESIGN COLLABORATIVE, LTD. SUBMITTAL REVIEW Submittal is reviewed for general conformance with design and general compliance with the Contract Documents. Corrections and/or comments made as part of this submittal review do not relieve contractor of responsibility from conformance with the Contract Documents, applicable codes and laws. The design professional does not warrant or represent that the information within the submittal is either accurate or complete. Sole responsibility for correct design, details and dimensions shall remain with the Contractor. Contractor is responsible for all dimensions, quantities and performance requirements for all means and methods for coordination of the work of all trades; for conformance with the Contract Documents, and for performing the work in a safe and satisfactory manner.……………… DATE: BY: NO EXCEPTIONS MAKE CORRECTIONS NOTED REVISE AND RESUBMIT REVIEWED REVIEWED PDC is not responsible for color and/or finish selections REJECTED REVIEWED Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 ORANGE COUNTY BID NO. 367-OC5474 Project Number 367-OC5474 Datasheets Ikio Products 1 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 www.ikioledlighting.com PRODUCT DETAILS info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. Technical Data Sheet Power (Selectable)60W-90W-120W-150W Voltage 120-277V | 277-347V Power Factor 0.9 Total Harmonic Distortion (THD)<15% Color Temperature (Selectable)3000K-4000K-5000K Color Rendering Index (CRI)≥80 Dimmable Lighting Control 0-10V Dimming Beam Angle 55° | 75° | 90° Operating Temperature -40ºF ~+113ºF Suitable Location WET Ingress Protection Rating (IP) 3000K (80CRI) 55°/5H5V Power Selectable Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens Efficacy Lumens EfficacyW 8200lm 137lm/W 8680lm 145lm/W 8830lm 147lm/W 9100lm 152lm/W 9530lm 9770lm 8540lm 9040lm 9160lm159lm/W 163lm/W 142lm/W 151lm/W 153lm/W 1190lm 133lm/W 12680lm 141lm/W 12890lm 143lm/W 13290lm 148lm/W 13920lm 14270lm 12470lm 13200lm 13380lm155lm/W 159lm/W 139lm/W 147lm/W 149lm/W 15450lm 129lm/W 16370lm 136lm/W 16640lm 139lm/W 17150lm 143lm/W 17970lm 18410lm 16100lm 17040lm 17270lm150lm/W 153lm/W 134lm/W 142lm/W 144lm/W 18700lm 125lm/W 19530lm 130lm/W 19840lm 132lm/W 20450lm 136lm/W 21430lm 21960lm 19200lm 20320lm 20600lm143lm/W 146lm/W 128lm/W 135lm/W 137lm/W 60W 90W 120W 150W 75°/6H6V 90°/6H6V 55°/5H5V 75°/6H6V 90°/6H6V 55°/5H5V 75°/6H6V 90°/6H6V 4000K (80CRI) 5000K (80CRI) IP65 LUMEN PERFORMANCE PART NUMBER & QUALIFICATIONS Ordering Part Number IK-TFFL-150W-30/40/50K-MV-DBR Control Photocell (Optional) Clear Tempered Glass Die-cast Aluminum Lens Housing Dark Bronze | Black | WhiteFinish Trunnion Mount | Knuckle Mount | Yoke Mount | Slip FitterMounting Options 50,000 5 Average Life (Hours) Warranty (Years) FEATURES Multi-configuration floodlight design with adjustable beam angles for diverse illumination needs. Field-selectable lumen output and color temperature for flexible on-site lighting customization. Precision optical lens system delivers uniform illumination with enhanced visual comfort. Die-cast aluminum housing ensures efficient heat dissipation and extended product lifespan. Multiple mounting options simplify installation across varied architec- tural and outdoor environments. APPLICATION AREAS Building Exteriors, Corridors, Billboards, Parks, Squares, Playgrounds Page | 1 TriFlex Flood Light Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-TFFL-150W-30/40/50K-MV-DBR March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 2 ACCEPTED FOR USE AS BOTH TYPE "A" AND "A1" FIXTURE Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 CCT And Power Field Selectable this fixture features selectable lumen output and color temperature, allowing on-site adjustments to match specific lighting needs. Built-in dusk-to-dawn photocell Ensures that our floodights only turn on when darkness is detected. That helps the fixture last longer — and saves money over that long life. You can turn the photocell on or off with a simple dip switch. Page | 2 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. 10.14" 2.36" DIMENSIONS (60W | 90W) Length (Inches) Width (Inches) 8.84" 11.95" (Knuckle Mount) Height (Inches) Height (Inches) 9.45" (Trunnion Mount)Height (Inches) 12.13" 2.8" DIMENSIONS (120W | 150W) ACCESSORIES (OPTIONAL) STRUCTURAL DESIGN PHOTOMETRICS Length (Inches) Width (Inches) 9.53" 17.09" (Slip Fitter) Height (Inches) Height (Inches) 14.17" (Yoke Mount)Height (Inches) Wire Guard Knuckle Assembly Supporter 55° 90°75° www.ikioledlighting.com Technical Data Sheet TriFlex Flood Light 10.14"10.94" 60W | 90W (Knuckle Mount) 60W | 90W (Trunnion Mount) 120W | 150W (Slip Fitter) 120W | 150W (Yoke Mount)8.84"14.17"9.53"12.13"2.8"11.95"8.84"9.45"2.36"2.36" 12.13"17.09"9.53"2.8" SELECTABLE BEAM ANGLE (medium/wide/very wide) 55°75°90° Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-TFFL-150W-30/40/50K-MV-DBR March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 3 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 www.ikioledlighting.com info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. Technical Data Sheet Page | 1 Parking Lots, Roadways, Commercial Complexes, Industrial Facilities, Outdoor Campuses Product Description Product Features Application Areas The IKIO’s Shoebox Areaa Light is designed to deliver reliable and efficient illumination for large outdoor environments. Its robust construction and advanced optical design ensure uniform light distribution while maintaining long-term performance in demanding conditions. The streamlined housing enhances durability and thermal management, supporting consistent operation over extended periods. With a versatile mounting design and energy-efficient LED technology, this fixture provides a practical lighting solution for commercial, industrial, and public outdoor spaces. Rugged die-cast aluminum housing ensures durability and long-term outdoor lighting reliability. Advanced heat sink structure enhances thermal management for consistent lighting performance. Precision optical system delivers uniform illumination with optimized light distribution. Low-profile aerodynamic design reduces wind load for stable pole-mounted installations. Multiple mounting options provide flexible installation for diverse outdoor lighting applications. Shoebox Area Light Dimensions Diagrams (Engine)23.32"23.32"19.22"19.02"20.4"13"5.39"15.6"15.6"15.6"15.6"15.6"13" 13" 6.97" 13"2.36" Ø0.87"Ø0.43" Ø0.55" 2" 3.74" 5.37" Ø2.52" Ø0.40"2.52"3.34"8"5.98"2.52"2.52"2.52"6.5"4.8"2.52"Net Weight 100W: 9.87lb 140W: 10.38lb 180W: 10.59lb Net Weight 100W: 9.82lb 140W: 10.34lb 180W: 10.55lb Net Weight 100W: 12.26lb 140W: 12.77lb 180W: 12.99lb Net Weight 100W: 8.58lb 140W: 9.10lb 180W: 9.31lb Net Weight 100W: 9.06lb 140W: 9.57lb 180W: 9.78lb Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SAL-140W-3CCT-LV-T3-BL March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 4 REJECTED Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Power (Selectable)60W-90W-120W-140W Voltage 120-277V | 347V-480V, 50/60Hz Power Factor ≥90% Total Harmonic Distortion (THD)≤20% Surge Protection 10kV | 20kV Color Temperature (Selectable)3000K-4000K-5000K Color Rendering Index (CRI)70 Dimmable Lighting Control 0-10V Dimming Light Distribution TYPE II | TYPE III | TYPE IV | TYPE V B3-U0-G3 Operating Temperature BUG Rating (Backlight, Uplight, and Glare) -40ºF ~+113ºF Suitable Location WET Average Life (Hours)50,000 Warranty (Years)5 Housing Die-cast Aluminum Finish White | Black | Dark Bronze | Silver Gray Page | 2 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. www.ikioledlighting.com Technical Data Sheet Shoebox Area Light Technical Specifications Lumens Performance 2 70 20000lm 147 lm/W 23000lm 164 lm/W 21000lm 150 lm/W 3 70 20000lm 147 lm/W 23000lm 164 lm/W 21000lm 150 lm/W 4 70 20000lm 147 lm/W 23000lm 164 lm/W 21000lm 150 lm/W 5 70 21000lm 150 lm/W 23500lm 168 lm/W 21500lm 154 lm/W 2 70 18000lm 150 lm/W 20000lm 167 lm/W 18500lm 154 lm/W 3 70 18000lm 150 lm/W 20000lm 167 lm/W 18500lm 154 lm/W 4 70 18000lm 150 lm/W 20000lm 167 lm/W 18500lm 154 lm/W 5 70 18500lm 154 lm/W 20500lm 171 lm/W 19000lm 158 lm/W 2 70 13800lm 153 lm/W 15200lm 169 lm/W 14200lm 158 lm/W 3 70 13800lm 153 lm/W 15200lm 169 lm/W 14200lm 158 lm/W 4 70 13800lm 153 lm/W 15200lm 169 lm/W 14200lm 158 lm/W 5 70 14000lm 156 lm/W 15600lm 172 lm/W 14500lm 161 lm/W 2 70 9400lm 157 lm/W 10300lm 172 lm/W 9700lm 162 lm/W 3 70 9400lm 157 lm/W 10300lm 172 lm/W 9700lm 162 lm/W 4 70 9400lm 157 lm/W 10300lm 172 lm/W 9700lm 162 lm/W 5 70 9600lm 160 lm/W 10500lm 175 lm/W 10000lm 167 lm/W 140W Setting Power Dist.type Lumens Efficacy Lumens Efficacy Lumens Efficacy CRI 3000K 4000K 5000K 120W 90W 60W 100% 80% 60% 40% Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SAL-140W-3CCT-LV-T3-BL March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 5 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Page | 3 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. www.ikioledlighting.com Technical Data Sheet Shoebox Area Light 1.Standard versatile mounting arm accommodates multiple drilling patterns as well as square and round poles 2.Optional for cast aluminum slipfitter mounting adapterʢCompatible with more IKIO mounting adaptors such as Tenon, suits for various applicationʣ Arm Mount (4"and 5"Square and Round poles) Standard versatile mounting arm is simple to install and can be used with existing poles for retrofit installations. Slipfitter Mount An optional cast aluminum mast arm adapter secures fixture head to nominal 2-3/8''O.D. horizontal steel tenon arm. Wall Mount Wall Mount is easy to install for direct wall mounting with 1/2' conduit wiring or standard J-box mounting Yoke Mount Die-cast aluminum trunnion is easily adapted to many surfaces and allows easy fixture aiming angles. Adjustable Arm Mount Standard versatile mounting arm is simple to install and can be used with existing poles for retrofit installations. Housing CCT & POWER Adjustable The one-piece die-cast housing with corrosion-resistant coating protection and the modular design extend the life of the luminaire while making it easy to maintain. Occupancy Sensor Optional occupancy sensor allows for security and energy saving. Photometry Optional Type II, TypeIII, TypeIV and TypeV Photometry as per applications. Photocell Dusk to dawn controls can be utilized via optional NEMA twist-lock photocell. Offer four selectable lumen output (40%/60%/80%/100%), and three selectable CCTs (30K/40K/50K) Mounting Optional for square,round pole mount,Slipfitter, wall mount, yoke mount. All mounting brackets are simple to operate, which can realize single operation and reduce labor costs. CCT 5KK 4KK 3KK POWER LV1 LV2 LV3 LV4 Product Specifications Mounting Options Ordering Information: Typical order example: IK-SAL-140W-3CCT-LV-T3-BL IK BRAND IK IKIO IK FAMILY SAL SAL Shoebox Area Light FINISH W POWER SELECTABLE 140 for 60W-90W-120W-140W (Power Selectable) CCT SELECTABLE 3CCT for 3000K-4000K-4000K (CCT Selectable) VOLTAGE LIGHT DISTRIBUTION LV for 120-277V HV for 347-480V WH for White BL for Black DBR for Dark Bronze SLG for Silver Gray T2 for Type II T3 for Type III T4 for Type IV T5 for Type V Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SAL-140W-3CCT-LV-T3-BL March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 6 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Page | 4 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. www.ikioledlighting.com Technical Data Sheet Shoebox Area Light Type 2 optics are ideal for applications where there is a need to space the luminaires farther apart along a road or pathway. The light distribution pattern is optimized for elongated areas, allowing for greater pole spacing without sacrificing lighting quality. Type 3 optics produce an asymmetrical pattern that directs the majority of the light forward and equally on both sides of the luminaire. In a back-to-back configuration, it creates a rectangular pattern which can extend pole spacings. Type 4 is suitable for applications where light is primarily required forward with minimal backlight.Typical installations include perimeter poles. Type 5 optics produce a symmetrical square distribution pattern that distributes light equally on all sides of the luminaire. Type 5 luminaires is universal for most area lighting applications Drilling TemplateRound pole5” 0.D. Connectingpiece Luminaire Connectingpiece Luminaire Square pole 2.7"0.98"0.98"Ø0.41" Ø0.55" Ø0.41" Type 2 Type 3 Type 4 Type 5 External Glare Shield External Glare Full Visor Plug-and-Play PIR Sensor PIR sensor: MSANT12VPH01 Bluetooth PIR sensor: Plug-and-Play Microwave Sensor Microwave sensor: MSANT12VMH01 Bluetooth microwave sensor 120-277V PIR Sensor PIR sensor: BRI823-B-D Bluetooth PIR sensor NEMA Photocell 3 pin NEMA Type: MS-PSUNVB1 3 pin NEMA Type(480V): JL-207F 7 pin NEMA Type: JL-241C Back Light Control Shield Mounting Dimensions Photometrics Accessories (Optional) Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SAL-140W-3CCT-LV-T3-BL March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 7 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Page | 5 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2026 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. www.ikioledlighting.com Technical Data Sheet Shoebox Area Light Additional Mounting Accessories 115mm(4.54i n.) 95mm(3. 7 2 i n . )O.D: 60mm(2-3/8in.)3 7 2 i n.) 101mm(3.96in.) • Provides wiring accessWALL BRACKET Mid-Pole tenon Bracket 90° Wall Mount Bracket with 2-3/8" O.D. Tenon NO. WM-SP-D Finish: Dark Bronze USE: The 90˚ wall mount bracket with 2-3/8" tenon attaches an Provides wiring access and abuilt-in 2-3/8" O.D. tenon to mount a for mounting. Mounting holes are spaced 3-1/4" apart.152.4mm(6in.)227.2mm(7.76 in.) 60mm (2 3/8in.)102±1mm(4.in.)Double 90‘ Horizontal Tenon Adaptor NO. R60-SP2-90-D Finish:Dark Bronze USE:The Bracket is designed to mount over 2-3/8” (60mm) O.D. Mount Horizontal Tenon and adjusted horizontally Triple 90’ Horizontal Tenon Adaptor NO. R60-SP3-90-D Finish:Dark Bronze USE:The Bracket is designed to mount over 2-3/8” (60mm) O.D. Mount Horizontal Tenon and adjusted horizontally Double 180‘ Horizontal Tenon Adaptor NO. R60-SP2-180-D Finish:Dark Bronze USE:The Bracket is designed to mount over 2-3/8” (60mm) O.D. Mount Horizontal Tenon and adjusted horizontally184mm(7.25in.)60mm(2 3/8in.)63.5mm(2.5in.) 101.6mm(4i n . )184mm(7.25in.)60mm(2 3/8in.)63.5mm(2.5in.) 101.6mm(4in.)184mm(7.25in.)60mm(2 3/8in.)63.5mm(2.5in.) 101.6mm( 4 i n . ) 5" Square Pole Mount with 2-3/8" O.D. Tenon No. 5SQ-SP-D Finish: Dark Bronze USE: For use with square, non-tapered steel and aluminum poles. Furnished with four 5/16" hex head stainless-steel bolts. Vertical tenon measures 2-3/8" O.D., and is made of steel tubing. Fixtures mounted to this bracket can be adjusted both vertically and horizontally.183.6mm(7.228in.)127±1 m m (5 in.) 60mm(2 3/8in.)76mm(3in.)4" Square Pole Mount with 2-3/8" O.D. Tenon No. 4SQ-SP-D Finish: Dark Bronze USE: For use with square, non-tapered steel and aluminum poles. Furnished with four 5/16" hex head stainless-steel bolts. Vertical tenon measures 2-3/8" O.D., and is made of steel tubing. Fixtures mounted to this bracket can be adjusted both vertically and horizontally.183.6mm(7.228in.)60mm(2 3/8in.) 102±1 m m (4.in.)76mm(3in.)POLE BRACKET 2-3/8” OD Horizontal Tenon Mid-Pole Bracket NO. SQ-SP-D Finish:Dark Bronze USE:2-3/8” OD Horizontal Tenon Mid-Pole Bracket is designed onto a 2-3/8” OD horizontal tenon 185mm(7.28in.)80.7(mm081 i 6 ).n60mm(2 3/8in.)100mm ( 3. 9 4 i n. )184mm(7.25in.)60mm(2 3/8in.)63.5mm(2.5in.) 101.6mm(4in.) Triple 120’ Horizontal Tenon Adaptor NO. R60-SP3-120-D Finish:Dark Bronze USE:The Bracket is designed to mount over 2-3/8” (60mm) O.D. Mount Horizontal Tenon and adjusted horizontally Quad 90’ Horizontal Tenon Adaptor NO. R60-SP4-90-D Finish:Dark Bronze USE:The Bracket is designed to mount over 2-3/8” (60mm) O.D. Mount Horizontal Tenon and adjusted horizontally184mm(7.25in.)60mm(2 3/8in.)63.5mm(2.5in.) 101. 6 m m ( 4 i n . ) Pole Bracket accessories-Tenon & Yoke Adaptor NO. SP-TR-D Finish: Dark Bronze USE: The 2-3/8” OD Tenon Mount Adaptor for Yoke Fixtures is a yoke mount onto a 2-3/8” OD tenon. It may be utilized with the 63mm(2.48in.)102±1mm (4 in.)108.6mm(4.28in.)154.5±1mm(6.08 in.)222.5mm(8.76in.)60mm(2 3/8 in.) 106.68mm(4.2in.)101.6mm(4in.)4" Round Pole Mount with 2-3/8" O.D. Tenon NO. 4SQR-SP-D Finish:Dark Bronze USE: For use with Round, non-tapered steel and aluminum poles. Furnished with three 3/8" hex head stainless-steel bolts. Vertical tenon measures 2-3/8" O.D., and is made of steel tubing. Fixtures mounted to this bracket can be adjusted both vertically and horizontally.222.5mm(8.76in.)60mm(2 3/8 in.) 131.86mm(5.19in.)101.6mm(4in.)5" Round Pole Mount with 2-3/8" O.D. Tenon NO. 5SQR-SP-D Finish:Dark Bronze USE: For use with Round, non-tapered steel and aluminum poles. Furnished with three 3/8" hex head stainless-steel bolts. Vertical tenon measures 2-3/8" O.D., and is made of steel tubing. Fixtures mounted to this bracket can be adjusted both vertically and horizontally. Pole Bracket Accessories –Angle-Adjustment Adapter NO. SQA-ALDA Finish: Dark Bronze USE: Durable brackets are engineered to provide versatile mounting options. These arms are made from rugged die-cast maximize the lighting effectiveness vertically and horizontally. Horizontal Wall or Square or Round pole mount with 2-3/8" Tenon Bracket NO. SQ/R-SP-D Finish: Dark Bronze USE: This tenon bracket can be installed onto a wall square pole round pole. Adjustable Arm Mount Kit NO.:SQADAL08-A Finish: Dark Bronze Description: Adjustable pole mount kit, suitable for 4” & 5” square or round pole Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SAL-140W-3CCT-LV-T3-BL March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 8 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 www.ikioledlighting.com Page | 1 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2024 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. Technical Data Sheet Steel Pole Straight Square SPECIFICATIONS: MOUNTING OPTIONS: DIMENSION: FEATURES FINISH Textured architectural bronze powder-coat finish, baked to ensure maximum paint adhesion, hardness and durability. ANCHOR BOLTS Anchor bolts' sizes are based on pole data charts for the selected pole size. HAND HOLE Cast iron reinforced hand hole and cover with ground screw. BASE COVER Poles are provided with a two-piece formed steel base cover that is easily assembled and fitted over pole base. SURFACE TREATMENT Hot-dip galvanizing. POLE LENGTH Poles are available in standard lengths as shown in the order matrix. Poles can be custom cut to order. SPECIFICATION 10FT 15FT 20FT 25FT 30FT IK-SS-10FT4-11G-D-T L 118” L 181.1” L 299.2” L 358.2” L 240.1” IK-SS-15FT4-11G-D-T IK-SS-20FT4-11G-D-T IK-SS-25FT4-11G-D-T IK-SS-30FT5-11G-D-T 4” Flange 5” Flange Flange Base Cover Anchor Bolt Positioning Plate Anchor Bolt SIDE MOUNT: Standard length poles are predrilled holes on 4 side, with a Tenon standard packaged on top. Also with hole plugs for unused predrilled locations. NOTE: When using Arm or Slip-Fitter Mounts, additional installation parts may be required to ensure proper installation. (For Example: with Slip-fitter a bullhorn will be the option) TOP MOUNT: Installing ARM (optional) will need to take-off the Tenon standard package and put rain cover on top. Dimensions 3” 5” 18” 10.51” 0.79” 10-30 FT 10.51”10.51”4.02”4.02”28” Ø8.27” 1.18”79” Ø11.42” 10.51” 10.51” 5.08” 28” Ø9.86”1.18”79” Ø11.42”10.91”10.91” 5.08” 5” 5.08”28”9.98”9.8”7.48”7.48”Ø4.3” Ø0.79” 79” 3.94”19.6”Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SS-25FT4-11G-D-T (BLACK) March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 9 REJECTED - NO POLES IN PROJECT Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 info@ikioledlighting.com | +1 844-533-4546 | www.ikioledlighting.com © 2024 IKIO LED LIGHTING. All Rights Reserved. Products and technologies in this document may be covered by one or more Patents Pending. The product images shown are for illustration purposes only and may not be an exact representation of the product. Specifications subject to change without notice. Page | 2 DIMENSION DATA INSTALLATION www.ikioledlighting.com Technical Data Sheet Straight Square Steel Pole CATALOG HEIGHT GAUGE WEIGHT (LBS) EPA 70 EPA 80 EPA 90 EPA 100 EPA 110 EPA 120 IK-SS-10FT4-11G-D-T 10' 10'-15'31.5" 35.4"35.4" 35.4" 31.5"59.1" 7.48"7.48"10.51" 10.51" 70.9" 82.7" 35.4" 20'-25' 30' 11 11” 101 25.2 23.5 20.3 19.4 17.3 15.6 IK-SS-15FT4-11G-D-T 15'4”x4”134 15.2 15.5 11.1 9.5 7.9 6.8 IK-SS-20FT4-11G-D-T 20' 169 10.2 9.3 7.5 4.1 4.2 3.6 IK-SS-25FT4-11G-D-T 25' 190 8.9 6.9 5.7 6.1 3.6 2.2 IK-SS-30FT5-11G-D-T 30' 5”x5” 8.27”-11.42” 9.86”-11.42” 286 Foundation refrence Specification 9.6 7.4 6.1 5.8 4.6 3.8 1.Dig a hole in the installation position of the lamp pole. Fixed four fastener fittings according to the hole position of lamp pole and poured with cement concrete. (as shown in the figure) 3"X5 2. Install 4 screws onto the stick and adjust to same water level, then place the square plate and screw tightly. Install the cover at the bottom of pole. (as shown in the figure) SIZE BASE BOLT CIRCLE Specification Refrence Design of Concrete Size Flange Base Cover Set Screws Concrete The Screw to Adjust the Water Level L W H Base Cover (40PCS) Job Name :ORANGE COUNTY BID NO. 367-OC5474 Manufacturer :IKIO Model Number & Description :IK-SS-25FT4-11G-D-T (BLACK) March 13, 2026 Index Prepared By: IKIO LED Lighting Ash K. | ashk@ikioledlighting.com 10 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 ORANGE COUNTY NORTH CAROLINA DISPUTE RESOLUTION RULES AND PROCEDURES FOR ORANGE COUNTY DESIGN, BUILDING CONSTRUCTION, RENOVATION, AND REPAIR PROJECTS RULE 1. INITIATING MEDIATED SETTLEMENT CONFERENCES A. Purpose of Mandatory Settlement Conferences. Pursuant to G.S. §143-128(f1) and 143- 135.26(11), these Rules are promulgated to implement a mediated settlement program designed to focus the parties’ attention on settlement rather than on claim preparation and to provide an opportunity for orderly settlement negotiations to take place. Nothing herein is intended to limit or prevent the parties from engaging in settlement procedures voluntarily at any time prior to or during commencement of the dispute resolution process. B. Initiating the Dispute Resolution Process 1. Any party to a County public construction contract (referred to herein generally as the “Contract”) governed by Article 8. Ch. 143 of the General Statutes and identified in G.S. § 143- 128(f1) and who is a party to a dispute arising out of the Contract and the construction process in which the amount in controversy is at least $15,000 may submit a written request to the County for mediation of the dispute. 2. Prior to submission of a written request for mediation to the County, the party requesting mediation should give notice of any and all claims in accordance with their respective contracts, obtain decisions on the claims as required or allowed by their respective contracts, and attempt to resolve the dispute according to the terms and conditions in their respective contracts. The Mediator may adjourn any mediated settlement conference if the Mediator believes, in his or her sole discretion, that the parties have not satisfied all of the terms and conditions of their respective contracts and that doing so will enhance the prospects for a negotiated settlement. C. Condition Precedent to Litigation. Before any party to a Contract may commence a civil action against the County seeking remedies for breach or non-performance of the Contract by the County, said party must first initiate the dispute resolution process under these rules and attend and participate in good faith in the mediated settlement conference. RULE 2. SELECTION OF MEDIATOR A. Mediator Listing. A List of Mediators acceptable to the County is maintained by the County Attorney and that list is incorporated by reference into these Rules. B. Selection of Mediator. The party requesting mediation shall select a Mediator from the List of Mediators and shall file, with the County, a Notice of Selection of Mediator within 21 days of the request for mediation. Such notice shall state the name, address, and phone number of the Mediator selected. If Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 the Mediator selected is not available or declines to participate for any reason, the requesting party shall select another person from the List of Mediators. If the party requesting mediation does not select and designate a mediator within 21 days of the request for mediation, the County shall have the right in its absolute discretion to appoint a mediator from its List of Mediators. C. Disqualification of Mediator. Any party may request replacement of the Mediator for good cause. Nothing in this provision shall preclude Mediators from disqualifying themselves. RULE 3. THE MEDIATED SETTLEMENT CONFERENCE A. Where Conference is to be Held. Unless all parties and the Mediator otherwise agree, the mediated settlement conference shall be held in county seat of Orange County. The Mediator shall be responsible for reserving a place, making arrangements for the conference, and giving timely notice of the time and location of the conference to all attorneys, unrepresented parties and other persons or entities required to attend. B. When Conference is to be Held. The mediation shall be completed within 90 days after selection of the Mediator unless all parties to the mediation agree to a different schedule. C. Request to Accelerate or Extend Deadline for Completion. Any party or the Mediator may request the County to accelerate or extend the deadline for completion of the conference. Such request shall state the reasons the acceleration or extension is sought and shall be served by the moving party upon the other parties and the Mediator. Objections to the request must be promptly communicated to the County and to the Mediator. The County, with the concurrence of the designated Mediator, may grant the request by adjusting the time for completion of the conference. D. Recesses. The Mediator may recess the mediation conference at any time and may set times for reconvening. If the Mediator determines the time and place where the conference is to reconvene before the conference is recessed, no further notice is required to persons present at the conference. E. Project Delay. The mediated settlement conference that results from a construction contract dispute shall not be cause for the delay of the construction project. RULE 4. DUTIES OF PARTIES AND OTHER PARTICIPANTS IN FORMAL DISPUTE RESOLUTION PROCESS A. Attendance. 1. All parties to the dispute must designate an official representative to attend the mediation. 2. “Attendance” means physical attendance, not by telephone or other electronic means. Any attendee representing a party must have authority from that party to bind it to any agreement reached as a result of the mediation. 3. Attorneys representing parties may attend the mediation, but are not required to do so. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 4. Sureties and insurance company representatives are required to physically attend the mediation unless the Mediator and all of the other parties to the mediation excuse their attendance or consent to their attendance by telephone or other electronic means. 5. The parties who attend a duly scheduled mediation conference shall have the right to recover their share of the Mediator’s compensation from any party or parties who fail to attend the conference without good cause. B. Finalizing Agreement. If an agreement is reached in the conference, the terms of the agreement shall be confirmed in writing and signed by all parties. C. Payment of Mediation Fee: Mediation Fees charged by the Mediator shall be paid in accordance with G.S. § 143-128(f1). D. Failure to Compensate Mediator. Any party’s failure to compensate the Mediators in accordance with G.S. § 143-128(f1) shall subject that party to a withholding by the County of said amount of money from the party’s payment or any other moneys owed by that party to the County. Should the County fail to compensate the Mediator, it shall hereby be subject to a civil cause of action from the Mediator for the County’s portion of the Mediator’s total fee as required by G.S. § 143-128(f1). RULE 5. AUTHORITY AND DUTIES OF MEDIATORS A. Authority of Mediator. 1.Control of Conference. The Mediator shall at all times be in control of the conference and the procedures to be followed. 2.Private Consultation. The Mediator may communicate privately with any participant or counsel prior to and during the conference. The fact that private communications have occurred with a participant shall be disclosed to all other participants at the beginning of the conference. 3.Scheduling the Conference. The Mediator shall make a good faith effort to schedule the conference at a time that is convenient with the participants, attorneys and Mediator. In the absence of agreement, the Mediator shall select the date for the conference. 4.Determining good cause for a party’s failure to appear at a scheduled mediation conference. B.Duties of Mediator. 1.The Mediator shall define and describe the following at the beginning of the conference: a.The process of mediation. b.The difference between mediation and other forms of conflict resolution. c.The costs of the mediated settlement conference. d.That the mediated settlement conference is not a trial, the Mediator is not a judge, and the parties retain their legal rights if they do not reach settlement; however, the Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 Mediator will advise all parties that failure to appear at mediation without good cause may result in imposition of sanctions and may be asserted as a bar to lawsuits by claimants who have failed to exhaust this administrative remedy. e.The circumstances under which the Mediator may meet and communicate privately with any of the parties or with any other person. f.Whether and under what conditions communications with the Mediator will be held in confidence during the conference. g.The inadmissibility of conduct and statements as provided by G.S. §7A-38.1(1). h.The duties and responsibilities of the Mediator and the participants. i.That any agreement reached will be reached by mutual consent. 2. Disclosure: The Mediator has a duty to be impartial and to advise all participants of any possible bias, prejudice or partiality. 3. Declaring Impasse: The Mediator may determine at any time during the mediation conference that an impasse exists and that the conference should end. 4. Reporting Results of Conference. The Mediator shall submit a written report to the County and the other parties within 10 days of the conference stating whether or not the parties reached an agreement. The Mediator’s report shall indicate the absence of any party from the mediated settlement conference without permission or good cause. 5. Scheduling and Holding the Conference. It is the duty of the Mediator to schedule the conference and conduct it prior to the deadline of completion set by the rules. The Mediator shall strictly observe deadlines for completion of the conference unless said time limit is changed by agreement of the parties. RULE 6. COSTS AND COMPENSATION OF THE MEDIATOR The Parties shall compensate the Mediator for mediation services at the rate proposed by the Mediator and agreed to by the parties at the time the Mediator is selected. The Parties shall be jointly responsible for the Mediator’s costs and expenses subject to Rule 4.C. above. Each Party is responsible for its own costs and expenses, including reasonable attorneys’ fees, related to the Meiation. RULE 7. RULE MAKING These Rules may be amended by the County at any time. Amendments will not affect mediations where claims or requests for mediation have been filed at the time the amendment takes effect . RULE 8. DEFINITIONS A. “County” shall mean Orange County North Carolina. B. “Project Designer” is that person or firm stipulated as project designer in the Contract Documents for the project. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Revised 01/24 C. “Claim” is a demand or assertion by a party seeking adjustment or interpretation of Contract terms, payment of money, extension of time or other relief with respect to the terms of the Contract. The term “Claim” also includes other disputes and matters in question between the parties to a Contract involved in the County’s building construction renovation and repair projects arising out of or relating to the Contract or the construction process. Claims must be initiated by a written notice. The responsibility to substantiate Claims shall rest with the party making the Claim. D. “Good Cause” generally includes any circumstance beyond the control of a party, which prevents that party from meeting obligations. When good cause is asserted as an excuse for a party’s failure to appear at a mediation conference or to otherwise comply with the requirements of these Rules, the Mediator, in his or her sole discretion, will determine whether good cause exists to excuse the party’s failure to appear or otherwise comply with these rules. RULE 9. TIME LIMITS A. Any time limit provided for by these Rules may be waived or extended at the sole discretion of the County, if no Mediator has been selected, and at the discretion of the County with concurrence of the Mediator if a Mediator has been selected. Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 COMMERCIAL AUTO CA 04 43 12 23 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. WAIVER OF TRANSFER OF RIGHTS OF RECOVERY AGAINST OTHERS TO US (WAIVER OF SUBROGATION) - AUTOMATIC WHEN REQUIRED BY WRITTEN CONTRACT OR AGREEMENT This endorsement modifies insurance provided under the following: AUTO DEALERS COVERAGE FORM BUSINESS AUTO COVERAGE FORM MOTOR CARRIER COVERAGE FORM With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by the endorsement. The Transfer Of Rights Of Recovery Against Others To Us Condition does not apply to any person(s) or organization(s) for whom you are required to waive subrogation with respect to the coverage provided under this Coverage Form, but only to the extent that subrogation is waived: A.Under a written contract or agreement with such person(s) or organization(s); and B.Prior to the "accident" or the "loss". CA 04 43 12 23 © Insurance Services Office, Inc., 2022 Page 1 of 1 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 COMMERCIAL AUTO CA 04 49 11 16 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. PRIMARY AND NONCONTRIBUTORY - OTHER INSURANCE CONDITION This endorsement modifies insurance provided under the following: AUTO DEALERS COVERAGE FORM BUSINESS AUTO COVERAGE FORM MOTOR CARRIER COVERAGE FORM With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by the endorsement. A.The following is added to the Other Insurance Condition in the Business Auto Coverage Form and the Other Insurance - Primary And Excess Insurance Provisions in the Motor Carrier Coverage Form and supersedes any provision to the contrary: This Coverage Form's Covered Autos Liability Coverage is primary to and will not seek contribution from any other insurance available to an "insured" under your policy provided that: 1.Such "insured" is a Named Insured under such other insurance; and 2.You have agreed in writing in a contract or agreement that this insurance would be primary and would not seek contribution from any other insurance available to such "insured". B.The following is added to the Other Insurance Condition in the Auto Dealers Coverage Form and supersedes any provision to the contrary: This Coverage Form's Covered Autos Liability Coverage and General Liability Coverages are primary to and will not seek contribution from any other insurance available to an "insured" under your policy provided that: 1.Such "insured" is a Named Insured under such other insurance; and 2.You have agreed in writing in a contract or agreement that this insurance would be primary and would not seek contribution from any other insurance available to such "insured". © Insurance Services Office, Inc., 2016 Page 1 of 1 CA 04 49 11 16 Policy Number: 1935061 Transaction Effective Date: 06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED BY CONTRACT ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE PART With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by the endorsement. A.WHO IS AN INSURED for "bodily injury" and "property damage" liability is amended to include: Any person or organization other than a joint venture, for which you have agreed by written contract to procure bodily injury or property damage "auto" liability insurance arising out of operation of a covered "auto" with your permission. However, this additional insurance does not apply to: (1)The owner or anyone else from whom you hire or borrow a covered "auto". This exception does not apply if the covered "auto" is a "trailer" connected to a covered "auto" you own. (2)Your "employee" if the covered "auto" is owned by that "employee" or a member of his or her household. (3)Someone using a covered "auto" while he or she is working in a business of selling, servicing, repairing, parking or storing "autos" unless that business is yours. (4)Anyone other than your "employees", partners (if you are a partnership), members (if you are a limited liability company), or a lessee or borrower or any of their "employees", while moving property to or from a covered "auto". (5)A partner (if you are a partnership), or a member (if you are a limited liability company) for a covered "auto" owned by him or her or a member of his or her household. B.The coverage extended to any additional insured by this endorsement is limited to, and subject to all terms, conditions, and exclusions of the Coverage Part to which this endorsement is attached. In addition, coverage shall not exceed the terms and conditions that are required by the terms of the written agreement to add any insured, or to procure insurance. C.The limits of insurance applicable to such insurance shall be the lesser of the limits required by the agreement between the parties, or the limits provided by this policy. D.Additional exclusions. The insurance afforded to any person or organization as an insured under this endorsement does not apply: 1.To "loss" which occurs prior to the date of your contract with such person or organization; 2.To "loss" arising out of the sole negligence of any person or organization that would not be an insured except for this endorsement. 3.To "loss" for any leased or rented "auto" when the lessor or his or her agent takes possession of the leased or rented "auto" or the policy period ends, whichever occurs first. Includes copyrighted material of Insurance Services Office, Inc. with its permission. CA-F-127 (03-03) Policy Number: 1935061 Transaction Effective Date:06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 COMMERCIAL GENERAL LIABILITY CG 20 01 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. PRIMARY AND NONCONTRIBUTORY - OTHER INSURANCE CONDITION This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART LIQUOR LIABILITY COVERAGE PART PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART The following is added to the Other Insurance Condition and supersedes any provision to the contrary: Primary And Noncontributory Insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured under your policy provided that: (1)The additional insured is a Named Insured under such other insurance; and (2)You have agreed in writing in a contract or agreement that this insurance would be primary and would not seek contribution from any other insurance available to the additional insured. © Insurance Services Office, Inc., 2018 Page 1 of 1 CG 20 01 12 19 Policy Number: 1935061 Transaction Effective Date: 06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 COMMERCIAL GENERAL LIABILITY CG 20 33 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED - OWNERS, LESSEES OR CONTRACTORS - AUTOMATIC STATUS WHEN REQUIRED IN A WRITTEN CONSTRUCTION AGREEMENT WITH YOU This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART A.Section II - Who Is An Insured is amended to include as an additional insured any person or organization for whom you are performing operations when you and such person or organization have agreed in writing in a contract or agreement that such person or organization be added as an additional insured on your policy. Such person or organization is an additional insured only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by: 1.Your acts or omissions; or 2.The acts or omissions of those acting on your behalf; in the performance of your ongoing operations for the additional insured. However, the insurance afforded to such additional insured: 1.Only applies to the extent permitted by law; and 2.Will not be broader than that which you are required by the contract or agreement to provide for such additional insured. A person's or organization's status as an additional insured under this endorsement ends when your operations for that additional insured are completed. B.With respect to the insurance afforded to these additional insureds, the following additional exclusions apply: This insurance does not apply to: 1."Bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or the failure to render, any professional architectural, engineering or surveying services, including: a.The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or b.Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional architectural, engineering or surveying services. © Insurance Services Office, Inc., 2018 Page 1 of 2 CG 20 33 12 19 Policy Number: 1935061 Transaction Effective Date: 06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 2."Bodily injury" or "property damage" occurring after: a.All work, including materials, parts or equipment furnished in connection with such work, on the project (other than service, maintenance or repairs) to be performed by or on behalf of the additional insured(s) at the location of the covered operations has been completed; or b.That portion of "your work" out of which the injury or damage arises has been put to its intended use by any person or organization other than another contractor or subcontractor engaged in performing operations for a principal as a part of the same project. C.With respect to the insurance afforded to these additional insureds, the following is added to Section III - Limits Of Insurance: The most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement you have entered into with the additional insured; or 2.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. Page 2 of 2 © Insurance Services Office, Inc., 2018 CG 20 33 12 19 Policy Number:1935061 Transaction Effective Date: 06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 COMMERCIAL GENERAL LIABILITY CG 24 53 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. WAIVER OF TRANSFER OF RIGHTS OF RECOVERY AGAINST OTHERS TO US (WAIVER OF SUBROGATION) - AUTOMATIC This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART ELECTRONIC DATA LIABILITY COVERAGE PART LIQUOR LIABILITY COVERAGE PART POLLUTION LIABILITY COVERAGE PART DESIGNATED SITES POLLUTION LIABILITY LIMITED COVERAGE PART DESIGNATED SITES PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART RAILROAD PROTECTIVE LIABILITY COVERAGE PART UNDERGROUND STORAGE TANK POLICY DESIGNATED TANKS The following is added to Paragraph 8. Transfer Of Rights Of Recovery Against Others To Us of Section IV - Conditions: We waive any right of recovery against any person or organization, because of any payment we make under this Coverage Part, to whom the insured has waived its right of recovery in a written contract or agreement. Such waiver by us applies only to the extent that the insured has waived its right of recovery against such person or organization prior to loss. © Insurance Services Office, Inc., 2018 Page 1 of 1 CG 24 53 12 19 Policy Number: 1935061 Transaction Effective Date: 06/30/2025 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 POLICY NUMBER: 1935061 COMMERCIAL GENERAL LIABILITY CG 25 03 05 09 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. D E SI GN AT ED C ON ST RU CT IO N PR O J E CT (S )G E NE RA L AG G R EG AT E LI M I T This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SCHEDULE Designated Construction Project(s): Each construction project as required by written contract or written agreement. Information required to complete this Schedule, if not shown above, will be shown in the Declarations. A.For all sums which the insured becomes legally obligated to pay as damages caused by "occurrences" under Section I - Coverage A, and for all medical expenses caused by accidents under Section I - Coverage C, which can be attributed only to ongoing operations at a single designated construction project shown in the Schedule above: 1.A separate Designated Construction Project General Aggregate Limit applies to each designated construction project, and that limit is equal to the amount of the General Aggregate Limit shown in the Declarations. 2.The Designated Construction Project General Aggregate Limit is th e most w e will pay f or the sum of all damages under Coverage A, except damages because of "bodily injury" or "property damage" included in the "products- completed operations hazard", and for medical expenses under Coverage C regardless of the number of: a.Insureds; b.Claims made or "suits" brought; or c.Persons or organizations making claims or bringing "suits". 3.Any payments made under Coverage A for damages or under Coverage C for medical expenses shall reduce the Designated Construction Project General Aggregate Limit for that designated construction project. Such payments shall not reduce the General Aggregate Limit shown in the Declarations nor shall they reduce any other Designated Construction Project General Aggregate Limit for any other designated construction project shown in the Schedule above. 4.The limits shown in the Declarations for Each Occurrence, Damage To Premises Rented To You and Medical Expense continue to apply. However, instead of being subject to the General Aggregate Limit shown in the Declarations, such limits will be subject to the applicable Designated Construction Project General Aggregate Limit. CG 25 03 05 09 © Insurance Services Office, Inc., 2008 Page 1 of 2 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66 B.For all sums which the insured becomes legally obligated to pay as damages caused by "occurrences" under Section I - Coverage A, and for all medical expenses caused by accidents under Section I - Coverage C, which cannot be attributed only to ongoing operations at a single designated construction project shown in the Schedule above: 1.Any payments made under Coverage A for damages or under Coverage C for medical expenses shall reduce the amount available under the General Aggregate Limit or the Products-completed Operations Aggregate Limit, whichever is applicable; and 2.Such payments shall not reduce any Designated Construction Project General Aggregate Limit. C.When coverage for liability arising out of the "products-completed operations hazard" is provided, any payments for damages because of "bodily injury" or "property damage" included in the "products-completed operations hazard" will reduce the Products-completed Operations Aggregate Limit, and not reduce the General Aggregate Limit nor the Designated Construction Project General Aggregate Limit. D.If the applicable designated construction project has been abandoned, delayed, or abandoned and then restarted, or if the authorized contracting parties deviate from plans, blueprints, designs, specifications or timetables, the project will still be deemed to be the same construction project. E.The provisions of Section III - Limits Of Insurance not otherwise modified by this endorsement shall continue to apply as stipulated. Page 2 of 2 © Insurance Services Office, Inc., 2008 CG 25 03 05 09 Docusign Envelope ID: 59DEBC52-4F3F-80F2-8076-D73999734C66