The URL can be used to link to this page

Home My WebLink About2021-586-E-AMS-Wayne Roofing & Sheet Metal Company-Motor Pool Facility Replace Existing Roof System Revised 06/21 1 [Departmental Use Only] TITLE Motor Pool Roof RFP5327 FY 2021-2022 NORTH CAROLINA CONSTRUCTION AGREEMENT UNDER $250,000.00 ORANGE COUNTY THIS CONSTRUCTION AGREEMENT (hereinafter called “Agreement”), made as of the 15th day of October, 2021, by and between Wayne Roofing and Sheet Metal Company, (hereinafter called the “Contractor”), and Orange County, a political subdivision of the State of North Carolina, (hereinafter called the “County,” “Orange County,” or “Owner”). W I T N E S S E T H: That the Contractor and the Owner, for the consideration herein named, agree as follows: 1. CONTRACT DOCUMENTS; PRIORITY The Contract Documents consist of this Agreement, the Request for Proposals, Proposal, Construction Drawings, and Written Specifications. The Contract Documents form the Contract. In the event of any inconsistency between or among the Contract Documents the Contract Documents shall be interpreted in the following order of priority: a. This Agreement. b. Designer Approved Bulletins and Field Orders. c. Request for Proposals and addenda thereto. d. Proposal. 2. SCOPE OF WORK The Contractor shall furnish and deliver all of the materials, and perform all of the work required by this Agreement within the time period stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner and in accordance with the following enumerated documents, which are made a part hereof as if fully contained herein: a. Construction Drawings prepared by Atlas Engineering, Inc (Sheet s COV, 1.0, 2.0, 2.1, 2.2, 2.3, 3.1, 3.2, 3.3 dated August 2021) b. Written specifications prepared by the project engineer. c. Wayne Roofing and Sheet Metal Company proposal dated September 14, 2021 which fully describes the work to be performed. Such work will hereafter be called the “Work”. d. Related documents listed under Section 1 above. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 2 3. TERM AND SCHEDULING a. The Contractor agrees to commence work pursuant to the written Notice to Proceed. b. The Contractor agrees to complete substantially all Work by October 15, 2022. c. Time is of the essence with respect to all dates specified in the Contract Documents as Completion Dates. d. The Contractor shall perform the Work in the time, manner, and form required by the Contract Documents and as stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner. e. It is expressly understood that the Owner will employ other contractors to perform work as a part of the Project whose work will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate its activities with such other contractors, particularly with respect to access to work areas, storage of materials and other common facilities. f. Should the Owner determine that the Contractor is behind schedule Owner may require, at no additional cost to the Owner, the Contractor to expedite and accelerate its efforts, including providing additional resources and working overtime, as necessary, to perform the Work in accordance with the approved project schedule. 4. STANDARD OF CARE a. The Contractor shall exercise reasonable care and diligence in performing the Work in accordance with the highest generally accepted standards of this type of Contractor practice throughout the United States and in accordance with applicable federal, state and local laws and regulations applicable to the performance of these services. Contractor is solely responsible for the professional quality, accuracy and timely completion and submission of all work. b. The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance or configuration. c. Contractor shall be responsible for all errors or omissions caused by its employees, agents, contractors, or assigns in the performance of the Agreement. Contractor shall correct any and all errors, omissions, discrepancies, ambiguities, mistakes or conflicts at no additional cost to the Owner. d. Contractor is an independent contractor of Owner. Any and all employees of the Contractor engaged by the Contractor in the performance of any work or services required of the Contractor under this Agreement, shall be considered employees or agents of the Contractor only and not of the Owner, and any and all claims that may or might arise under any workers compensation or other law or contract on behalf of said employees while so engaged shall be the sole obligation and responsibility of the Contractor. e. If activities related to the performance of this Agreement require specific licenses, certifications, or related credentials Contractor represents that it or its employees, agents DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 3 and subcontractors engaged in such activities possess such licenses, certifications, or credentials and that such licenses certifications, or credentials are current, active, and not in a state of suspension or revocation. f. The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor and Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, or control, and all such property while it is in transit. g. The Contractor is solely responsible for obtaining all permits necessary to complete the Work in compliance with all local, state, and federal laws. 5. PAYMENT & TAXES a. The Owner hereby agrees to pay to the Contractor for the faithful performance of this Agreement, and the Contractor hereby agrees to perform all of the Work for a sum not-to- exceed Two Hundred Nine Thousand, Four Hundred Seven Dollars ($209,407.00). Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Owner’s Representative, generally the architect if an architect is retained on the Work, a Request for Payment for work done during the previous calendar month. i. The Request for Payment shall be in form of a standardized invoice or AIA Document G702-703 appropriately addressed to Owner’s Representative at 551A Pylon Drive, Raleigh, NC 27606 and shall show substantially the value of work done during the previous calendar month. ii. The amount due for payment shall be ninety-five percent (95%) of the value of work completed since the last Request for Payment and this amount shall be paid by the Owner on or before the last business day of the month. Owner shall retain five percent (5%). 1. Upon Owner’s Representative’s certification that ninety percent (90%) of the Work has been satisfactorily completed retainage may be discontinued. Retainage may be discontinued, at Owner’s Discretion, so long as work continues to be completed satisfactorily and on schedule. iii. Final payment shall not be due to the Contractor until thirty (30) days after one hundred percent (100%) of the Work, including punch list work, has been satisfactorily (as determined by the County) completed and an appropriate affidavit as required in Section 7(c) below has been received by Owner. b. Should Owner reasonably determine that Contractor has failed to perform the Work related to a Request for Payment, Owner, at its discretion may provide the Contractor ten (10) days to cure the breach. Owner may withhold the accompanying payment without penalty until such time as Contractor cures the breach. i. Should Contractor or its representatives fail to cure the breach within ten (10) days, or fail to reasonably agree to such modified schedule, Owner may immediately terminate this Agreement in writing, without penalty or incurring further obligation to Contractor. ii. This section shall not be interpreted to limit the definition of breach to the failure to perform the Work related to a Request for Payment. c. The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. It shall be the Contractor's DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 4 responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of its subcontractors. 6. INSURANCE AND BONDS a. Minimum requirements – Contractor shall obtain, at its sole expense, Commercial General Liability Insurance, Automobile Insurance, Workers’ Compensation Insurance, and any additional insurance as may be required by Owner’s Risk Manager as such insurance requirements are described in the Orange County Risk Transfer Policy and Orange County Minimum Insurance Coverage Requirements (each document is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). If Owner’s Risk Manager determines additional insurance coverage is required such additional insurance shall be designated here N/A (if no additional insurance required mark N/A as being not applicable). Contractor shall not commence construction work until such insurance is in effect and certification thereof has been received by the Owner's Risk Manager. b. Performance Bonds – Contractor shall furnish bonds covering the faithful performance of the Contract and payment of all obligations arising under any of the Contract Documents or related in any way to the Work. Contractor shall immediately furnish a copy of such bonds to any requesting person who appears to be a potential beneficiary of bonds covering payment obligations arising under any of the Contract Documents. This subsection 6(b) applies only to Contracts of fifty thousand dollars ($50,000.00) or more where the total cost for the project is three hundred thousand dollars ($300,000.00) or more. 7. INDEMNITY a. To the extent authorized by North Carolina law the Contractor shall indemnify, without limitation, and hold harmless to the maximum extent permitted by law the Owner and its agents and employees from and against any and all claims, damages, loss es and expenses, including attorney's fees, arising out of or resulting from the performance or nonperformance of the Work, provided that any such claim, damages, loss or expense (A) is attributable to bodily injury, sickness, disease or death or injury to, or destruction of, property, including the loss of use resulting therefrom; and (B) is caused in whole or in part by any breach of any provision of the Agreement or by any negligent or wrongful act or omission of the Contractor, any Subcontractor, or supplier of the Contractor, anyone directly or indirectly employed by any of them or anyone for whose acts any of them may be liable. The indemnification obligation under this paragraph shall not be limited in any way by any limitation of the amount or type of damages, compensation or benefits payable by or for the Contractor or any subcontractor under workers' compensation acts, disability benefits acts or other employee benefit acts. It is the intent of this section that the Contractor shall indemnify the County to the maximum extent allowed by law. b. The Contractor shall indemnify and hold harmless Owner from any lien of whatever type through the purchase of appropriate bonds and insurance as designated in Section 6 above. In the event any such lien is filed against Owner’s property Contractor shall, through such bonds and insurance or at Contractors expense, defend Owner against all such claims of lien. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 5 c. Upon completion of the Work the Contractor shall execute an affidavit stating there are no unpaid debts for any work that has been done or materials that have been furnished to the project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such debts and liens. Such indemnification shall be in a form and substance acceptable to Owner. d. By executing this Agreement Contractor agrees to abide by and be bound by the indemnification provisions herein and of Section 7(c) specifically. 8. DISPUTE RESOLUTION AND GOVERNING LAW a. Any dispute with respect to any provision of, or the performance or non-performance of, this Agreement shall be subject to the Dispute Resolution Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). b. The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement or the Contract shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. c. Notice of any claim by Owner or Contractor must be initiated by written notice to the other Party within thirty (30) days of the occurrence of the event giving rise to the claim or within thirty (30) days of the discovery of the event or condition giving rise to the claim, whichever is later. i. Should any claim be made, regardless of whether such claim is made by Owner or Contractor, Contractor shall continue to faithfully and diligently perform the Work in such a manner as to meet all scheduled timelines. Any failure to faithfully and diligently perform the Work may be deemed, by the Owner, a breach of the Contract. ii. If a claim is made such claim shall be made to the initial decision maker, if applicable, who may request more supporting data, reject the claim in whole or in part, approve the claim in whole or in part or advise the parties the claim is unable to be resolved. iii. If a claim is made by the Owner the Owner may, but is not obligated to, notify the surety. 9. NON–APPROPRIATION a. Contractor acknowledges that Owner is a governmental entity, and the validity of this Agreement is based upon the availability of public funding under the authority of its statutory mandate. b. In the event that public funds are unavailable or not appropriated for the performance of Owner’s obligations under this Agreement, then this Agreement shall automatically expire DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 6 without penalty to Owner immediately upon written notice to Contractor of the unavailability or non-appropriation of public funds. It is expressly agreed that Owner shall not activate this non-appropriation provision for its convenience or to circumvent the requirements of this Agreement. c. In the event of a change in the Owner’s statutory authority, mandate or mandated functions, by state or federal legislative or regulatory action, which adversely affects Owner’s authority to continue its obligations under this Agreement, then this Agreement shall automatically terminate without penalty to Owner upon written notice to Contractor of such limitation or change in Owner’s legal authority. 10. NOTICES Any notice required by this Agreement shall be in writing and delivered by certified or registered mail, return receipt requested to the following: Owner: Contractor: Orange County Wayne Roofing & Sheet Metal Company Attn: A. Barnes Attn: Hunter Steed P.O. Box 8181 PO Box 941 Hillsborough, NC 27278 Goldsboro, NC 27533 11. MISCELLANEOUS a. Duties and Obligations imposed by the Contract Documents shall be in addition to any Duties and Obligations imposed by state, federal or local law, rules, regulations and ordinances. b. No act or failure to act by the Owner or Contractor shall constitute a waiver of any right or duty granted them under the Contract Documents, nor shall any act or failure to act constitute any approval except as specifically agreed in writing. c. The Work shall be tested and inspected as required by the Contract Documents and as required by law. Unless prohibited by law the costs of all such tests and inspections related to state and federal codes such as ADA, Administrative, Electrical, Plumbing, Mechanical and Building Codes shall be borne by the Contractor. The costs for material and structural testing shall be conducted by an independent third party at the expense of the Owner. Delays related to any of the aforementioned tests and inspections shall not be grounds for delaying the completion of the work. If any such tests and inspections reveal deficiencies in the Work such that the Work does not comply with terms or requirements of the Contract Documents and the requirements of any code or law the Contractor is solely responsible for the cost of bringing such deficiencies into compliance with the terms of the Contract Documents and any code or law. d. Should the Architect, if an architect is retained for the project involving the Work, or Owner reject any portion of the Work for failing to comply with the Contract Documents Contractor shall immediately, at Contractor’s expense, correct the Work. Any such rejection may be made before or after substantial completion. If applicable, any additional expense borne by the Architect under this section shall be paid at Contractor’s expense. e. The Contractor shall not assign any portion of this Agreement nor subcontract the Work in DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 7 its entirety without the prior written consent of the Owner. f. By executing this Agreement Contractor affirms that Contractor and any subcontractors of Contractor are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. g. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. h. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. i. The County has designated (Angel Barnes) to act as the County's representative with respect to the Work and shall have the authority to render decisions within guidelines established by the County Manager or the County Board of Commissioners and shall be available during working hours as often as may be reasonably required to render decisions and to furnish information. j. Contractor shall at all times remain in compliance with all applicable local, state, and federal laws, rules, and regulations including but not limited to all state and federal non- discrimination laws, policies, rules, and regulations and the Orange County Non- Discrimination Policy and Orange County Living Wage Policy (each policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Any violation of the Orange County Non-Discrimination Policy is a breach of this Agreement and County may immediately terminate this Agreement without further obligation on the part of the County. This paragraph is not intended to limit and does not limit the definition of breach to discrimination. k. This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. l. In the event of a breach by Contractor Owner has sole authority to determine the reasonableness of Contractor’s actions to remedy such breach or complete the performance of its obligations. m. Upon request of the Owner, the Contractor shall submit to County all relevant documentation, including but not limited to, job cost records, to support its claims for final compensation and if such request is made final compensation shall not be due until all relevant documentation is received, reviewed, and approved by Owner. 12. CONSEQUENTIAL AND LIQUIDATED DAMAGES a. Owner and Contractor mutually waive any claim against each other for consequential damages. Consequential Damages include: DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 8 i. Damages incurred by Owner for loss of use, income, financing, or business. ii. Damages incurred by Contractor for office expenses, including personnel, loss of financing, profit, income, business, damage to reputation, or any other non-direct damages. b. Liquidated damages shall be in accord with the Contract Documents. If the Contract Documents do not otherwise address liquidated damages, such damages shall be in the amount of five hundred dollars ($500.00) per day. 13. TERMINATION OR SUSPENSION a. The Owner may, without cause, order the Contractor to terminate, suspend, delay or interrupt the Work in whole or in part for such period of time as the Owner may determine. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is not due to or as a result of any fault on the part of the Contractor or any subcontractor, the Contractor may recover a per diem amount of five hundred dollars ($500.00) per day with a not-to-exceed limit of ten thousand dollars ($10,000.00). ii. In the event of termination by the Owner under this Agreement, the Contractor shall be entitled to receive its reasonable and documented direct costs prior to termination, including the cost of materials purchased for the Work which purchases cannot be canceled or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the work in a safe and efficient manner. iii. If Owner elects to suspend or terminate the contract pursuant to subparagraphs 13.a.i. or 13 a.ii. the sole remedy available to the Contractor are those listed in the subparagraphs and Contractor is not entitled to any right to further claims for any amount owed or disputed or for payment of damages alleged to have been sustained as a result of Owner’s order to delay, suspend, or interrupt the Work. b. The Owner may, with cause, order the Contractor to suspend, delay or interrupt the Work in whole or in part for such period of time as the cause remains. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is due to or as a result of any fault on the part of th e Contractor or any subcontractor, the Owner may reduce payment at a per diem amount of five hundred dollars ($500.00) per day. c. Contractor may terminate the Contract if, at the Owner’s written direction, the Work is stopped for twenty one (21) consecutive days through no act or fault of the Contractor, their agents or employees, or a subcontractor or their agents or employees or any other person performing work pursuant to the Contract Documents. Contractor may terminate the Contract if a Court or other Public authority having jurisdiction enters a lawful order that requires all work to be stopped and such stoppage lasts for twenty one (21) consecutive days. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 9 d. Either party may terminate this Agreement upon notice to the other party that obligations pursuant to this Agreement are made impossible due to declarations of emergency by Orange County or by North Carolina due to events directly impacting Orange County. Both parties shall remain responsible for all payment and performance due up to the receipt of such notice, but shall have no further obligation or responsibility beyond that date provided the terminating party has taken all reasonable steps to complete the performance of its obligations. 14. ENTIRE AGREEMENT All of the documents listed, referenced or described in this Agreement, the written Notice-to- Proceed, together with Modifications made or issued in accordance herewith are the Contract Documents, and the work, labor, materials and completed construction required by the Contract Documents and all parts thereof is the Work. The Contract Documents constitute the entire agreement between Owner and Contractor. This Agreement may be amended only by written instrument signed by both parties. Modifications may be evidenced by facsimile signatures. If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. IN WITNESS WHEREOF, the Parties hereto have executed this Agreement as of the day and date first above written wholly or in a number of counterparts each of which shall, without proof or accounting for other counterparts, be deemed an original contract. ORANGE COUNTY CONTRACTOR ____________________________________ ________________________________________ Signature Signature County Manager ________________________________________ Printed Name and Title DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Hunter Steed 10/14/2021 vp 10/18/2021 Revised 06/21 10 ORANGE COUNTY—DEPARTMENT USE ONLY ______________________________________________________________________________ Party/Vendor Name: Wayne Roofing & Sheet Metal Company Party/Vendor Contact Person: Hunter Steed (hlswayneroofing@yahoo.com) Contact Phone: 919.734.5475 Party/Vendor Address: PO Box 941 City Goldsboro State: NC Zip: 27533 Department: AMS Amount: $209,407.00 (includes base bid plus alternate 1 Purpose: Motor Pool Facility Replace Existing Roof System Budget Code(s): 61370035-882000-30002 Vendor # 66729 (N/A if new vendor) Vendor is a BOCC consultant? Yes No Contract Type: (Check one) New Renewal Amendment Effective Date 10/15/2021 Approved by Board Yes No Agenda Date: --- For Section XIV. c. contracts only, Approved by Board in Current FY Budget Yes No This agreement is approved as to technical form and content and I as Department Director affirmatively state work on this project has not been initiated prior to execution of the a greement: Department Director’s Signature ________________________________________ Date: ________ Agreements for emergency services or repair are not subject to the above affirmation. If services related to this agreement have already begun or been completed please briefly describe the nature of the emergency condition that was addressed: N/A Risk Management This agreement is approved for sufficiency of insurance standards, specifications, and requirements: Office of the Risk Management Officer___________________________________ Date: _________ Financial Services This instrument has been pre-audited in the manner required by the Local Government Budget and Fiscal Control Act: Office of the Chief Financial Officer ____________________________________ Date: _________ Legal Services This agreement is approved as to legal form and sufficiency: Office of the County Attorney __________________________________________Date: ________ Clerk to the Board Received for record retention: All Docusign contracts must be copied to the Clerk upon completion: occlerkdocs@orangecountync.gov The following signature block is for hard copies only and is not required for Docusign contracts: Office of the Clerk to the Board __________________________________________Date:_________ DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 10/14/2021 10/15/2021 10/18/2021 10/18/2021 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ORANGE COUNTY NONDISCRIMINATION CERTIFICATION The undersigned bidder or proposer hereby certifies and agrees that the following information is correct: 1. In preparing its enclosed bid or proposal, the undersigned bidder or proposer has considered all bids and proposals submitted from qualified, potential subcontractors and suppliers, and has not engaged in discrimination as defined in Section 12 -52 of the Orange County Non-discrimination Ordinance. 2. Without limiting any other remedies that Orange Co unty may have for a false certification, it is understood and agreed that, if this certification is false, such false certification will constitute grounds for Orange County to reject the bid or proposal submitted with this certification, and terminate any contract awarded based on such bid or proposal. It shall also subject the bidder or proposer to disqualification from participating in county contracts or bid processes for up to two years. 3. As a condition of contracting with Orange County, the undersigned bidder or proposer agrees to promptly provide to Orange County all information and documentation that may be requested by Orange County from time to time regarding the solicitation and selection of suppliers and subcontractors in connection with this solicitation process. Failure to maintain or failure to provide such information constitutes grounds for Orange County to reject the bid or proposal and to terminate, without penalty to Orange County, any contract awarded on such bid or proposal. All such information and documentation shall be maintained for a period of three years after the expiration of the contract. 4. As part of its bid or proposal, the undersigned bidder or proposer shall provide to Orange County a list of all instances within the past ten years where a complaint was filed or pending against bidder or proposer in a legal or administrative proceeding alleging that bidder or proposer discriminated against its subcontractors, vendors, suppliers, or commercial customers, and a description of the status or resolution of that complaint, including any remedial action taken. 5. As a condition of submitting a bid or proposal to Orange County the undersigned bidder or proposer agrees to comply with the Orange County Non-discrimination Ordinance. Falsification of this certification shall constitute a violation of the Orange DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 1 GUIDELINES FOR RECRUITMENT AND SELECTION OF MINORITY BUSINESSES These guidelines were adapted for use on this project by the County of Orange from the “Guidelines for Recruitment and Selection of Minority Businesses for Participation in State Construction Office Projects”, developed by the State Construction Office. In accordance with G.S. 143-128.2 (SB 914 ratified December 6, 2001), the County of Orange has enacted a verifiable ten percent (10%) minority business participation goal for the total monetary value of this project. These guidelines are published to accomplish that end. SECTION 1: INTENT It is the intent of these guidelines that the County of Orange, as awarding authority for construction projects, and the contractors and subcontractors performing the construction contracts awarded shall cooperate and in good faith do all things legal, proper and reasonable to achieve the statutory goal of ten percent for participation by minority businesses in each construction project permitted by SB 914. Nothing contained in these guidelines shall be considered to require awarding authorities to award contracts or to make purchase of materials or equipment from minority-business contractors who do not submit the lowest responsible bid or bids. SECTION 2: DEFINITIONS 1. Minority - a person who is a citizen or lawful permanent resident of the United States and who is: a. Black, that is, a person having origins in any of the black racial groups in Africa; b. Hispanic, that is, a person of Spanish or Portuguese culture with origins in Mexico, South or Central America, or the Caribbean Islands, regardless of race; c. Asian American, that is, a person having origins in any of the original peoples of the Far East, Southeast Asia and Asia, the Indian subcontinent, the Pacific Islands; d. American Indian or Alaskan Native, that is , a person having origins in any of the original peoples of North America; e. Female. f. “Socially disadvantaged individual”, as defined in 15 U.S.C. 637. These are individuals who have “been subjected to racial or ethnic prejudice or cultural bias because of their identify as a member of a group without regard to their individual qualities”; or g. “Economically disadvantaged individual” as defined in 15 U.S.C. 637. This is an individual “whose ability to compete in the free enterprise system has been impaired due to diminished capital and credit opportunities as compared to others in the same business who are not socially disadvantaged.” 2. Minority Business - means a business: a. In which at least fifty-one percent (51%) is owned by one or more minority persons, or in the case of a corporation, in which at least fifty-one percent (51%) of the stock is owned by one or more minority persons; and DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 2 b. Of which the management and daily business operations are controlled by one or more of the minority persons who own it. 3. Owner - The County of Orange. 4. Bidder - Any person, firm, partnership, corporation, association, or joint venture seeking to be awarded a public contract or subcontract. 5. Contract - A mutually binding legal relationship or any modification thereof obligating the seller to furnish equipment, material or services, including construction, and obligating the buyer to pay for them. 6. Contractor - Any person, firm, partnership, corporation, association, or joint venture which has contracted with the County of Orange to perform construction work or repair. 7. Subcontractor - A firm under contract with the Prime Contractor for supplying materials or labor and materials and/or installation. The subcontractor may or may not provide materials in his subcontract. Work subcontracted in an emergency and which could not have been anticipated is excluded as a part of this program. 8. Verifiable goal means that the awarding authority has adopted written guidelines specifying the actions that the prime contractor must take to ensure a good faith effort in the recruitment and selection of minority businesses for participation in contracts awarded; the required actions must be documented in writing by the contractor to the appropriate awarding authority. SECTION 3: RESPONSIBILITIES 1. Minority Business Program of the County of Orange (hereafter referred to a Minority Business Program). The Minority Business Program will establish a program pursuant to which it shall certify to interested persons, businesses qualifying as Minority Business Enterprises (MBE). The information solicited from the applicant will be used by the Minority Business Program to: a. Determine MBE certification, i.e., that those certified are MBEs under GS 143- 128 as a contractor and/or subcontractor. b. Identify those areas of work for which there are certified MBEs, as requested. c. Provide interested parties with a list of prospective certified MBE contractors and subcontractors. d. Assist in the determination of technical assistance in the certification program that needs to be provided. In addition to being responsible for the certification of those small and emerging businesses that want to participate, the Minority Business Program will: 1. Maintain a current list of certified MBEs of those certified. The list furnished shall include the areas of work in which each MBE is interested. 2. Work with the North Carolina Association of Minority Businesses, the Carolinas Branch AGC, the Carolina Electrical Contractors Association and the North Carolina Association of Plumbing-Heating-Cooling Contractors in developing and implementing a certification program intended to improve the ability of MBE’s to compete in this program. 2. Owner DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 3 The owner will: a. Attend the scheduled prebid conference. b. Identify or determine those work areas of a contract where MBEs may have an interest in performing contract work. c. At least ten (10) days prior to the scheduled day of bid opening, the Owner will notify certified MBEs of potential contracting opportunities listed in the proposal. The notification will include the following: 1. A description of the work for which the bid is being solicited. 2. The date, time and location where bids are to be submitted. 3. The name of the individual within the agency/institution who will be available to answer questions about the project. 4. Where bid documents may be reviewed. 5. Any special requirements that may exist, such as insurance, licenses, bonds and financial arrangements. If there are more than three (3) certified MBEs in the general locality of the project who offer similar contracting or subcontracting services in the specific trade, the Owner shall notify three (3) , but may contact more, if the Owner so desires. d. Maintain documentation of any contacts, correspondence, or conversations with MBE firms made in an attempt to meet the goals. 2. Prime Contractor Under the single prime contract system, the prime contractor will: a. Attend the scheduled prebid conference. b. Identify or determine those work areas of a contract where MBEs may have an interest in performing contract work. c. At least ten (10) days prior to the scheduled day of bid opening, notify certified MBEs of potential contracting opportunities listed in the proposal. The notification will include the following: 1. A description of the work for which the bid is being solicited. 2. The date, time and location where bids are to be submitted. 3. The name of the individual within the agency/institution who will be available to answer questions about the project. 4. Where bid documents may be reviewed. 5. Any special requirements that may exist, such as insurance, licenses, bonds and financial arrangements. If there are more than three (3) certified MBEs in the general locality of the project who offer similar contracting or subcontracting services in the specific trade, the Contractor shall notify three (3) , but may contact more, if the Contractor so desires. d. During the bidding process, comply with the contractor(s) requirements listed in the proposal for minority participation. e. Submit with the bid a description of that portion of the work to be executed by MBEs expressed as a percentage of the total price. f. Identify the MBEs the bidder intends to use on the contract, along with the dollar amount of the work to be performed by each minority business. g. Submit an affidavit that details the good faith efforts taken to procure minority business participation. h. Upon being named the apparent low bidder, the bidder shall provide the necessary DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 4 documentation as listed in the contract documents. Failure to comply with procedural requirements as defined in contract documents may render that bid as non-responsive and may result in rejection of the bid and award to the next lowest responsible and responsive bidder. i. Upon being named apparent low bidder, the bidder shall provide an affidavit that lists the proportion of the work to be performed by MBEs. If the MBEs do not account for ten percent (10%) of the contract price, the bidder must submit an affidavit that verifies the bidder’s good faith efforts by certifying that it has undertaken at least five of the following ten (10) steps: 1. Contacted minority businesses that reasonably could have been expected to submit a quote and that were known to the contract or available on these State or local government-maintained lists at least ten (10) days before the bid or proposal date and notifying them of the nature and scope of the work to be performed. 2. Made the construction plans, specifications, and requirements available for review by prospective minority businesses, or providing these documents to them at least ten (10) days before the bid proposals are due. 3. Broke down or combined elements of work into economically feasible units to facilitate minority participation. 4. Worked with minority trade, community, or contractor organizations identified by the Office of Historical Underutilized Businesses and included in the bid documents that provided assistance in recruitment of minority businesses. 5. Attended any prebid meetings scheduled by the public owner. 6. Provided assistance in getting required bonding or insurance or providing alternatives to bonding or insurance for subcontractors. 7. Negotiated in good faith with interested minority businesses and did not reject them as unqualified without sound reasons based on their capabilities. Any rejection of a minority business based on lack of qualifications should have the reasons documented in writing. 8. Provided assistance to an otherwise qualified minority business in need of equipment, loan capital, lines of credit, or joint pay agreements to secure loans, supplies, or letters of credit, including waiving credit that is ordinarily required. Assisted minority businesses in obtaining the same unit pricing with the bidder’s suppliers in order to help the minority businesses in establishing credit. 9. Negotiated joint venture and partnership arrangements with minority businesses in order to increase opportunities for minority business participation on a public construction or repair project when possible. 10. Provide quick pay agreements and policies to enable minority contractors and suppliers to meet cash-flow demands. j. During the construction of the project, if it becomes necessary to replace an MBE subcontractor, advise the owner of the circumstances involved. k. If, during the construction of a project, additional subcontracting opportunities become available, make a good faith effort to solicit subbids from MBEs. 3. MBE Responsibilities DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 5 While MBEs are not required to become certified in order to participate in this program, it is recommended that they become certified and should take advantage of the appropriate technical assistance that is made available. In addition, MBEs who are contacted by owners or bidders must respond promptly whether or not they wish to submit a bid. SECTION 4: DISPUTE PROCEDURES It is the policy of this County that disputes between an agency and another person that involve a person’s rights, duties, or privileges should be settled through informal procedures. To that end, MBE disputes arising under these guidelines should be resolved, if possible, by informal proceedings arranged by the Owner. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid MBForms 2002-Revised July 2010 Identification of HUB Certified/ Minority Business Participation I, , (Name of Bidder) do hereby certify that on this project, we will use the following HUB Certified/ minority business as construction subcontractors, vendors, suppliers or providers of professional services. Firm Name, Address and Phone #Work Type *Minority **HUB Category Certified (Y/N) *Minority categories: Black, African American (B), Hispanic (H), Asian American (A) American Indian (I), Female (F) Socially and Economically Disadvantaged (D) ** HUB Certification with the state HUB Office required to be counted toward state participation goals. The total value of minority business contracting will be ($) . Wayne Roofing & Sheet Metal Co 0 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E &RQWUDFWRU¶V6DIHW\5HFRUG,QIRUPDWLRQ 7KH&RQWUDFWRU¶VVDIHW\UHFRUGVKDOOEHUHYLHZHGDQGHYDOXDWHGLQDGGLWLRQWRRWKHUTXDOLW\DQG SHUIRUPDQFHFULWHULDDVSDUWRIELGHYDOXDWLRQSURFHVV)DLOXUHWRSURYLGHWKHUHTXHVWHG LQIRUPDWLRQDQGGRFXPHQWDWLRQPD\UHVXOWLQUHMHFWLRQRI\RXUELGDVQRQUHVSRQVLYH $FFRUGLQJO\DOOELGGHUVPXVWVXEPLWWKHIROORZLQJLQIRUPDWLRQUHJDUGLQJWKHLUVDIHW\UHFRUG 7KHIROORZLQJGHILQLWLRQVVKDOODSSO\WRWKLVVHFWLRQ ³'$57LQFLGHQWUDWH´±$FURQ\PIRU³'D\V$ZD\5HVWULFWLRQVDQG7UDQVIHUV´7KH '$57LQFLGHQWUDWHPD\EHXVHGWRVKRZWKHUHODWLYHOHYHORILQMXULHVDQGLOOQHVVHVZLWKLQ DILUPFRPSDUHGWRWKHLQGXVWU\,WLVEDVHGRQO\RQWKRVHLQMXULHVDQGLOOQHVVHVVHYHUH HQRXJKWRZDUUDQW³'D\V$ZD\5HVWULFWLRQVDQG7UDQVIHUV´7KH'$57LQFLGHQWUDWHLV FDOFXODWHGXVLQJ26+$¶V)RUPDQGWKHIROORZLQJIRUPXOD 1XPEHURIHQWULHVLQFROXPQ+GD\VDZD\IURPZRUNFROXPQ,MREWUDQVIHURU UHVWULFWLRQ[1XPEHURIKRXUVZRUNHGE\DOOHPSOR\HHV '$57,QFLGHQW UDWH ³(05´±$FURQ\PIRU³([SHULHQFH0RGLILFDWLRQ5DWH´LVDQLQGLFDWRURIDFRQWUDFWRU¶V SDVWVDIHW\SHUIRUPDQFHZLGHO\XVHGE\WKHLQVXUDQFHLQGXVWU\DVDQHTXLWDEOHPHDQVRI GHWHUPLQLQJSUHPLXPVIRUZRUNHUV FRPSHQVDWLRQLQVXUDQFH7KHUDWLQJV\VWHPFRQVLGHUV WKHDYHUDJHZRUNHUV FRPSHQVDWLRQORVVHVIRUDJLYHQILUP VW\SHRIZRUNDQGDPRXQWRI SD\UROODQGSUHGLFWVWKHGROODUDPRXQWRIH[SHFWHGORVVHVWREHSDLGE\WKDWHPSOR\HULQD GHVLJQDWHGUDWLQJSHULRGXVXDOO\WKUHH\HDUV7KHUDWLQJLVEDVHGRQFRPSDULVRQRIILUPV GRLQJVLPLODUW\SHVRIZRUNDQGWKHHPSOR\HULVUDWHGDJDLQVWWKHDYHUDJHH[SHFWHG SHUIRUPDQFHLQHDFKZRUNFODVVLILFDWLRQ/RVVHVLQFXUUHGE\WKHHPSOR\HUIRUWKHUDWLQJ SHULRGDUHWKHQFRPSDUHGWRWKHH[SHFWHGORVVHVWRGHYHORSDQH[SHULHQFHUDWLQJ ³26+$´±$FURQ\PIRUWKH)HGHUDO2FFXSDWLRQDO+HDOWKDQG6DIHW\$GPLQLVWUDWLRQ 7KHWHUP³26+$´DVXVHGLQWKLV3ROLF\DOVRUHIHUVWRDQ\VWDWHRUORFDODJHQF\KDYLQJ MXULVGLFWLRQDODXWKRUL]DWLRQWRHQIRUFHZRUNHUVDIHW\UHTXLUHPHQWVDQGDVVHVVILQHVRU ZDUQLQJVIRUYLRODWLRQRIZRUNHUVDIHW\VWDQGDUGV 26+$'$57,QFLGHQW5DWH3URYLGHWKHELGGHU¶V'$57,QFLGHQW5DWH FDOFXODWHGIURP26+$¶V)RUPIRUWKHODVWWKUHH\HDUVDQGWKHRWKHUUHTXLUHG LQIRUPDWLRQVKRZQLQWKHH[DPSOHWDEOHEHORZ7KHELGGHUPXVWDWWDFKDOOVXSSRUWLQJ GRFXPHQWDWLRQDQGFDOFXODWLRQVLQFOXGLQJFHUWLILHG26+$IRUPV DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E <($5&2175$&725 '$57 ,1&,'(175$7( ,1'8675< '$57 ,1&,'(175$7( ,1'8675<),(/'$1'&2'( ([SHULHQFH0RGLILFDWLRQ5DWH(053URYLGHWKHELGGHU¶VPRVWUHFHQW ([SHULHQFH0RGLILFDWLRQ5DWH(05EDVHGRQLQVXUDQFHFODLPVKLVWRU\7KHELGGHU PXVWSURYLGHWKHVRXUFHRIWKH(05LQIRUPDWLRQDQGFRQWDFWLQIRUPDWLRQRILQVXUHUHQWLW\ SURYLGLQJWKH(05 <($5&2175$&725 (05 ,1'8675<),(/'$1' &2'( 1$0($1'&217$&7 ,1)2)25(05 ,1)250$7,21 $QVZHUWKHIROORZLQJ26+$6SHFLILF4XHVWLRQV D :LWKLQWKHODVW\HDUVKDVWKHELGGHUUHFHLYHGDQ\FLWDWLRQVFODVVLILHGE\ 26+$DVEHLQJVHULRXVZLOOIXODQGRUUHSHDWYLRODWLRQVZKHUH\RXU FRPSDQ\RSHUDWHV" <HVBBBBB1RBBBBBBBB ,I\HVDWWDFKDFRS\RIHDFKVXFKFLWDWLRQDQGYLRODWLRQ E +DVWKHELGGHUH[SHULHQFHGDQ\ZRUNUHODWHGIDWDOLWLHVZLWKLQWKHODVWILYH \HDUV" <HVBBBBBB1RBBBBBB 2020 2019 2018 0 0 0 0 0 0 2020 .85 Assured Partners Cindy Shumpert 803-732-6331 238160 23160 23160 23160 x x DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E F +DVWKHELGGHUKDGDQ\FLWDWLRQVLVVXHGE\26+$DVDUHVXOWRIZRUN UHODWHGIDWDOLWLHVZLWKLQWKHSDVW\HDUV" <HVBBBBBB1RBBBBBB G ,VWKHELGGHUXQGHULQYHVWLJDWLRQIRUDQ\ZRUNUHODWHGIDWDOLWLHV" <HVBBBBBB1RBBBBBB H,I\RXUDQVZHULV³\HV´WREFRUGSURYLGHDFRS\RIWKHFLWDWLRQV OLVWRIQXPEHUVRIIDWDOLWLHVDQGGRFXPHQWHGH[SODQDWLRQRIWKHIDWDOLW\ 6DIHW\3ODQ D 'RHVWKHFRPSDQ\KDYHDZULWWHQVDIHW\SURJUDPWKDWLQFOXGHV UHVSRQVLELOLW\IRUDOODVSHFWVRIVDIHW\PDQDJHPHQW" <HVBBBBBBBBB1RBBBBBBB E 'RHVWKHFRPSDQ\KDYHDZULWWHQSODQIRUVDIHW\WUDLQLQJRIQHZ HPSOR\HHVDQGRQJRLQJWUDLQLQJRIH[LVWLQJHPSOR\HHV" <HVBBBBBBBBB1RBBBBBBB F 'RHVWKHFRPSDQ\KDYHGRFXPHQWHGHYLGHQFHRIVDIHW\WUDLQLQJWKDWWKH\ KDYHFRQGXFWHG" <HVBBBBBBBBB1RBBBBBBB G ,IWKHFRPSDQ\KDVHPSOR\HHVZLWKOLPLWHG(QJOLVKDELOLW\GRHVWKH FRPSDQ\KDYHDZULWWHQSODQIRUHQVXULQJWKDWWKHLUHPSOR\HHVXQGHUVWDQGWKH WUDLQLQJWKH\DUHEHLQJJLYHQ" <HVBBBBBBBBB1RBBBBBBB H'RDOOVXSHUYLVRUVKDYHDQDSSURSULDWHGRFXPHQWHGOHYHORI26+$WUDLQLQJ HJDPLQLPXPRIKRXU26+$FRQVWUXFWLRQVDIHW\WUDLQLQJ" <HVBBBBBBBBB1RBBBBBBB x x x x x x x DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E I'RHPSOR\HHVKDYHGRFXPHQWHGEDVLF26+$KRXUFRQVWUXFWLRQVDIHW\ WUDLQLQJ" <HVBBBBBBBBB1RBBBBBBB J'RHVWKHFRPSDQ\KDYHDGRFXPHQWHG+D]DUG&RPPXQLFDWLRQ3URJUDP" <HVBBBBBBBBB1RBBBBBBB 5HTXLUHG:ULWWHQ([SODQDWLRQRI6DIHW\5HFRUG,IWKHELGGHUKDVDQ\RIWKHIROORZLQJ D'$57LQFLGHQWUDWHJUHDWHUWKDQLWVLQGXVWU\DYHUDJHEDQ(05JUHDWHUWKDQF DQVZHUHG³\HV´WRDQ\RIWKH26+$6SHFLILF4XHVWLRQDERYHRUGDQVZHUHG³QR´WRDQ\RIWKH 6DIHW\3ODQTXHVWLRQVWKHELGGHUVKDOOSURYLGHWKH&RXQW\LQLWVELGDGHWDLOHGZULWWHQ H[SODQDWLRQRILWVVDIHW\UHFRUGDQGWKHUHDVRQVZK\VXFKVDIHW\KLVWRU\LV127UHSUHVHQWDWLYHRI LWVIXWXUHSHUIRUPDQFHDQGZKDWVSHFLILFDFWLRQVLWKDVWDNHQWRLPSURYHLWVRYHUDOOVDIHW\UHFRUG )DLOXUHWRSURYLGHDZULWWHQH[SODQDWLRQRILWVVDIHW\UHFRUGSXUVXDQWWRWKLVSDUDJUDSKPD\EH GHHPHGDVQRQUHVSRQVLYHE\WKH&RXQW\ x x DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E HOT WORK PERMIT PROGRAM COMPLIANCE WITH THIS PUBLICATION IS MANDATORY OFFICE OF PRIMARY RESPONSIBILITY This instruction establishes policy and procedures and assigns responsibilities and requirements to ensure a comprehensive policy and program exists to perform work during new construction, repair, renovations and/or alterations that require hot work. It applies to all Orange County employees, contractors, and tenants on Orange County premises. Violations of this policy may result in appropriate disciplinary action to include administrative actions such as written or criminal prosecution under applicable North Carolina State Statue. 1.Objective. To assess the risk associated with hot work and prevent loss by fire. 2.Definitions 2.1. Hot Work: Hot Work is defined as any temporary or permanent operation that produces flames, sparks or heat. Hot work is not necessarily an occasional occurrence; it is often conducted as part of production processes in normal manufacturing operations. This includes, but is not limited to: cutting, grinding, brazing, welding, sawing, soldering, thawing pipes, sweating pipes or applying roofing materials with torches and sealing plastic shrink wrap. 2.2. Hot Work Shop: Any work shop that does hot work as part of its normal duties. Hot Work Shops will be inspected by the Orange County Fire Marshal annually and the shop will be given a "Hot Work Permit" for one year. 2.3. Hot Work Sites: Immediate area where hot work is to be accomplished. Includes all areas adjacent (includes above, below, and next to work site) to, on opposite side of wall surfaces, and an area encompassing a Thirty-five foot (35 ft.) radius around the immediate area where hot work is to be performed. 2.4. Hot Work Permit Form: A Hot Work Permit is a three-part form issued for all hot work. The Hot Work Permit Form may be obtained from project managers with Asset Management & Solid Waste Management and will be the only recognized form for use. 2.5. Non-Permissible Areas 2.5.1. See NFPA 51B:5.3 2.5.1.1. Hot Work Shall not be permitted in the following areas: 2.5.1.1.1. In areas not authorized by management 2.5.1.1.2. In sprinklered buildings where sprinklers are impaired, unless the requirements of NFPA 25, et al, are met. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 2.5.1.1.3. In the presence of explosive atmospheres (i.e. where mixtures of flammable gases, vapors, liquids, or dust with air exists) 2.5.1.1.4. In the presence of unclear or improperly prepared equipment, drums, tanks, or other containers that previously contained materials that could develop explosive atmospheres 2.5.1.1.5. In areas with an accumulation of combustible dusts that could develop explosive atmospheres. 2.5.2. Devices: Devices refer to any smoke detector, heat detector, duct smoke detector, beam detector or any other fire alarm system detection device that might require deactivation during hot work. (Manual fire alarm pull stations will not be deactivated during hot work.) 2.5.3. Device Number(s): 2.5.4. Addressable Fire Alarm Systems: Device Number refers to the individual number assigned to each detection device that might be impacted by Hot Work. 2.5.5. Conventional Hard Wired Systems: detection devices are not given an individual number; the Fire Zone along with room locations should be utilized. 2.6. Fire Safety Supervisor: Is responsible for enforcing the hot work policy, activities of fire watch and all outside contractors. 2.6.1 First and foremost, he or she has to decide if there is a safer way to complete the job or if hot work is the only option. 2.6.2 If hot work is the only option, determine if hot work can be performed in the area identified. Hot work must be prohibited in any area where the hazard cannot be eliminated or controlled. “No hot work” signs should be clearly posted. 2.6.3 If there is no alternative to hot work and the area in question is fire-safe, the fire safety supervisor authorizes the hot work by issuing FM Global’s Hot Work Permit. The job is then discussed with the person performing fire watch and hot work operator after following the precautions identified on the permit. 2.6.4 Oversees and manages the activities of the fire watch and outside contractors, providing approval signatures as required on the permit. 2.6.5 Once a decision has been made to use the hot work permit form, the fire safety supervisor shall work with the contractor performing hot work to complete Part 1 and issue the permit. The second page shall be taken out, scanned and electronically sent to Orange County Fire Marshal’s Office. The copy shall be retained with project management. The risk manager shall be notified of any hot work in Orange County facilities by email and telephone. 919-245-2155. acornetto@orangecountync.gov 2.7 Fire Watch: The job of the fire watch is to prevent fire and be ready to respond if one starts with the following duties: Stays near the person performing the hot work Closes all fire doors Makes sure the work area remains free of combustibles and tarpaulins are not moved DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Pays particular attention to hot work jobs at elevated locations, on the building roof, on walls or inside buildings with multiple floors; these areas often are not watched carefully enough and frequently have ignited from stray sparks smoldering long after workers have left the job site Never leaves the area while work is in progress or during breaks, such as lunch, unless relieved by a qualified replacement Stops the hot work if improper conditions develop Is ready to sound the alarm and use an extinguisher or fire hose if a fire starts After completion of the Hot Work, a selected trained individual with an appropriate fire extinguisher provided by the contractor doing work must remain in the immediate area of the Hot Work to ensure that a fire does not start. Fire Watch must be maintained constant for 1 hour after the completion of hot work and every half-hour for the additional 3 hours. If smoldering is detected the Fire Watch will follow the RACE procedures: R Remove persons from danger A Activate the fire alarm system C Close all windows and doors E Extinguish the fire or evacuate the area. 3 Procedures 3.6 Supervisors, Project Managers, and Contractors will determine if welding, cutting, soldering and/ or heating is absolutely necessary as part of the project or work order and there are no alternative options to complete the job. If hot work is required, it will be the responsibility of the supervisor, project manager, or contractor to determine if the work can be performed outside the facility. Hot Work conducted outside still requires a permit be obtained. If outside, maintain a minimum of 35ft away from any structure or other combustible. If hot work cannot be completed outside the facility, a Hot Work Permit is required and will be completed in accordance with the procedures in Part 1 of the hot work permit. 3.7 Regardless of completing the work outside or inside the facility, the general fire safety guidelines outlined in this section shall be followed. 3.8 Permit Issue: Hot Work Permits can be issued by Asset Management project manager or designee. Hot Work Permits shall be requested at least 24 hours or last working day in advance of needed work. 3.9 Individuals issuing Hot Work Permits will ensure that: 3.9.1 Hot work site is acceptable for Hot Work and that there are no excessive combustibles or combustible/flammable liquids in the hot work area; 3.9.2 Individual(s) performing the Hot Work understand the minimum safety precautions as outline on the Hot Work Permit by completing the appropriate blocks on the form; DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 3.9.3 A copy of the Hot Work Permit is forwarded to the Orange County Fire Marshal Division prior to starting any hot work; unless it is deemed “emergency work”, but still must be approved by Asset Management Project Manager. 3.9.4 Original copy of the Hot Work Permit is posted in the hot work area in clear view; 3.9.5 If a Fire Watch is required that the appropriate information is completed on the Hot Work Permit Form. 3.9.6 Hot Work Permits are issued on a day-to-day basis, with the exception of designated “Hot Work Zones”. Hot Work Zones are approved by the Orange County Fire Marshal Division after a site visit, and are typically granted for long-term projects only. A “Hot Work Zone” permit may be issued for work requiring daily hot work over a lengthy period of time. 4 Notification: 4.6 It is the responsibility of the individual performing the Hot Work to ensure that Asset Management notifies the appropriate fire alarm monitoring company, Orange County’s insurance carrier through the risk manager and the Orange County Fire Marshal Division to the initiation and upon completion of any Hot Work. 5 Enforcement: 5.6 Orange County Fire Marshal Division has the responsibility to spot check hot work permits to ensure compliance. Permits may be revoked if the safety precautions have been violated. 5.7 The Asset Management Department has the responsibility to ensure only trained and certified personnel complete the Hot Work permit and that only qualified individuals perform Hot Work. 5.8 A designated Hot Work Supervisor must be onsite during all Hot Work Operations 6 Training: 6.6 All Orange County personnel that issue, spot check or perform hot work shall complete online annual training and obtain certification. All contractors that perform hot work shall complete online annual training. No individual may complete a Hot Work Permit or perform hot work without this certification. Asset Management will maintain all records of training completion. Go to https://fmglobaltraining.skillport.com/skillportfe/custom/login/fmglobal/fmgloballogin.a ction?path=fmglobal/login/FmglobalLoginAction&lang=en for access to the program. Once logged in the FM Global’s Client Training Center, type hot work in the Search bar and press Search. Take the Managing Hot Work Using FM Global’ s Hot Work Permit System and How To Fill Out A Hot Work Permit. A copy of your certificate shall be submitted to Asset Management. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 7 Coordination and Approval 7.6 Any requested changes to this policy will be coordinated with Asset Management, Risk Management and the Orange County Fire Marshal prior to the change being implemented 7.7 All departments annotated below have coordinated and given their approval via signature to this Hot Work Program Operating Instruction 7.8 Asset Management Project Managers or are to sign with their approval, the Hot Work Permit, indicating that the site has been inspected for safety prior to work, as instructed on the Hot Work Form, and that a Fire Watch will be maintained by trained personnel or approved methods (i.e. detection systems in working order). The signee assumes responsibility for the work site and workers. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ADDENDUM #1 PRE-BID MEETING MINUTES MOTOR POOL ROOF REPLACEMENT ORANGE COUNTY, HILLSBOROUGH, NC BID No. 367-OC5327 ATLAS PROJECT NO. J2400 MEETING DATE: August 31, 2021 ATTENDEES: Angel Barnes – Orange County Asset Management Services* Rob Tatum – Atlas Engineering Allyson Coltrane – Orange County Transportation Services Theo Letman – Orange County Transportation Services Mathew Melton – Patriot Roofing Company Brady Knowles – Owens Roofing, Inc. Maurice Dozier – Dozier Built Zarek Smith – Montgomery Contractors, inc David Wright – ATD Restoration *Did not attend meeting  Key project team members were introduced. Ms. Angel Barnes is t he project manager for Orange County. Ms. Allyson Coltrane will be the building representative. Mr. Rob Tatum is the Project Manager for Atlas Engineering and will be the primary source of contact for the Designer.  A sign-in sheet was circulated. The pre-bid meeting is non-mandatory, but it is the only time the contractor may visit the site. All addendum(s) will be e-mailed. If the addendum needs to be sent to someone other than who was at the pre-bid, the additional e-mail address should be written on the sign- in sheet.  A thumb drive with the specifications, drawings, and photos of the facility were distributed.  Submit bids via email (pdf format), to the Orange County Purchasing Agent jamaro@orangecountync.gov by September 16, 2021, no later than 5:00 p.m. There will not be a formal opening. Results will be made available after award.  Bidders shall include the Form of Proposal, E-Verify Affidavit, Living Wage Certification, Nondiscrimination Certification, MBE Affidavit A or B, and Contractor’s Safety Record Information (See Attached Forms). North Carolina sales and use tax shall be included in the bid amount.  Questions concerning the bid document are to be directed to JoVana Amaro, Purchashing Agent, Orang County Financial Services jamaro@orangecountync.gov.  Contractor was reminded to review Orange County Minimum Insurance Coverage requirements in the project manual.  A Bid Bond is not required. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E  Contractors must have the proper license as required by the State of North Carolina. General Contractors must have a license classification for Building.  Performance and Payment Bonds will not be required for one hundred percent of the contract price.  The proposal shall be valid for a period of 90 days.  The owner reserves the right to reject any or all bids and to waive informalities.  The contractors were reminded to read the “Notice to Bidders” and follow all requirements. The contractor will have to meet the insurance requirements.  Last day for questions is 5:00 p.m. on September 7, 2021 and no addenda will be issued after 5:00 p.m. September 10, 2019. Acknowledge all addenda on the proposal.  Contractor will have 75 consecutive calendar days from the Notice to Proceed to complete the project. Liquidated damages will be imposed at a rate of $500 per day beyond the date of Final Acceptance. The Notice to Proceed will be issued after a delivery date for materials is confirmed.  The contractor is to include the unit quantities in Section 012100, Item 1.03A into their base bid. Fill out “unit prices” on the Form of Proposal. Any unused base bid quantities will be credited back to Orange County through a change order at the end of the project.  Contractor is responsible to review the Hot Work Permit Program in the project manual. The contractor is to follow the FM Global Hot Work Permit process and has a minimum of 4-hour fire watch. Workers will have to complete the FM Global training program and obtain a certificate. Copies of the certificate will be provided to Orange County.  All shutdowns must be approved in writing in advance by Orange County. A minimum of 72-hour notice before any shut down is required. More advanced notice may be required for pieces of equipment.  The Summary of Work and notes in Section 010100, Item 1.01.B were reviewed.  The contractor must have prior experience with the materials/systems to be installed, have performed projects of similar size and scope, and shall have been in business a minimum of five years prior to the date of bid.  The contractor must maintain the same project manager and superintendent throughout the project duration unless a change is reviewed and agreed upon by the Owner.  The contractor must provide temporary power, toilet, and sanitary facilities. The contractor may use the Owner’s water if available.  Refer to Section 016000, Item 1.03 for substitution request. Substitution request must come from the contractor. Substitutions not in accordance with this section will not be reviewed.  Portions of the drawings were reviewed. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E  Bidders should fully examine the Project Documents and existing site conditions prior to submitting their bid. If there are any questions regarding the design intent, or any errors or discrepancies in the drawings or documents are found, bidders should immediately notify the Designer to allow for correction or clarification in an addendum to all bidders. Addendum No. 1 will include the pre-bid meeting minutes and to respond to any unanswered questions. Addenda will be sent to each plan holder including eligible bidders, manufacturers, or subcontractors. The person attending the pre-bid meeting will receive such addenda unless a different contact person from that company has been requested.  A walk through was conducted. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Bid Page #1 COUNTY OF ORANGE FINANCIAL SERVICES – PURCHASING PO BOX 8181 HILLSBOROUGH, NORTH CAROLINA 27278 ORANGE COUNTY BID NO. 367-OC5327 RFP DATE: August 23, 2021 ATTENTION: INTERESTED VENDORS Orange County requests your competitive quotation to furnish the it em(s) listed below for Orange County Motor Pool Roof Replacement, 600 Hwy 86 North, Hillsborough, NC 27278 . A non-mandatory site visit is scheduled for August 31at 2:00 at the site. We will meet at 600 Hwy 86 North, Hillsborough NC 27278, at the Orange County Motor Pool Building. This is the only scheduled time for contractors to view the site. By submission of a bid, the contractor acknowledges he/she fully understands the extent of the project. Please transmit this quotation via email (pdf format), to the Orange County Purchasing Agent- jamaro@orangecountync.gov by September 16, 2021 no later than 5:00pm ITEM # COMMODITIES/GOODS OR SERVICES 1 Provide a labor and materials to replace the existing shingle roof system per the drawings (COV, 1.0, 2.0, 2.1, 2.2, 2.3, 3.1, 3.2, and 3.3) and specifications provided by Atlas Engineering, Inc. dated August 2021. All work shall be performed during normal hours of operation (Monday – Friday 8am to 5pm) All shutdown work requires a 72 hour notice to owner. Contractor must complete FM Global Hot Work Permit Training within the last year if performing hot work. SUBMIT PRICING ON ATTACHMENT A PLEASE STATE FIRM DELIVERY TIME TO START AFTER RECEIPT OF PURCHASE ORDER: _____________ DAYS PLEASE STATE NUMBER OF DAYS TO COMPLETE THE PROJECT AFTER COMMENCEMENT: _____________ DAYS Will any people working on this job make less than $14.95 per hour YES _______ NO ______ If yes, the lowest hourly wage to be paid any em ployee shall be: $ ____ / HOUR **SEE ATTACHED INSTRUCTIONS TO BIDDERS** License _____________ (if applicable) FIRM NAME ________________________________________ BY ______________________________________________ (Proposal must be signed in writing) ADDRESS __________________________ FAX: _____________________________________________ __________________________ TELEPHONE: ______________________________________ EMAIL: ___________________________________________ DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Bid Page #2 COUNTY OF ORANGE FINANCIAL SERVICES – PURCHASING PO BOX 8181 405 Meadowlands Drive HILLSBOROUGH, NORTH CAROLINA 27278 Instructions to Bidders 1. All bids and proposals shall be for furnishing apparatus, supplies, materials, equipment and/or work and services in accordance with the applicable plans and specifications prescribed by Orange County. Plans and/or specifications may be obtained online from Orange County Finance Department Purchasing Division webpage: https://www.orangecountync.gov/Bids.aspx 2. Orange County reserves the right to: o award lowest responsible bidder that is responsive, o to reject any or all bids, o And to waive minor irregularities. 3. The successful bidder shall comply fully with the requirements of General Statutes, Section 143-129 and 143-131, as amended. This is an informal range; therefore there will not be a formal opening. Results will be made available after award. 4. In the event of default by any contractor or vendor Orange County may procure from other sources whatever service or item is being bid, and holds the contractor responsible for any excess cost occasioned thereby. 5. Payment by check or Electronic Funds Transfer is due thirty days after completion and inspection unless otherwise specifically provided; subject to any discounts allowed. 6. North Carolina sales and use tax shall be included in the bid amount. 7. Bids submitted via email shall be accepted and are the preferred receipt method. Email to jamaro@orangecountync.gov. 8. Proposals received after opening date and time shall not be considered. 9. Bids must be signed and submitted on the attached form of proposal 10. The successful contractor shall be responsible for obtaining all permits and inspections. 11. The successful contractor shall be required to agree to and sign the Orange County Construction Agreement (copy attached). Among the items included in that agreement are the County’s Insurance requirements and sales tax. 12. All contractors are hereby notified that they must have proper license under the State laws governing their respective trades. Please display license number on your submittal. 13. Please direct questions concerning this bid document to Jovana Amaro, Purchasing Agent, Orange County Financial Services, (919) 245-2651 or via email at jamaro@orangecountync.gov . Please direct any questions about the scope, site visit, details of the work, or the proposal to: Angel Barnes, Orange County Capital Projects Manager, Orange County AMS 919-245-2628 abarnes@orangecountync.gov 14. A non-mandatory site visit is scheduled for August 31, 2021 2:00 pm at the site. We will meet at 600 Hwy 86 North, Hillsborough NC 27278 This is the only scheduled time for contractors to view the site. By submission of a bid the contractor acknowledges he/she fully understands the extent of the project. 15. HB786 im poses E-Verify requirements on contractors who enter into certain contracts with state agencies and local governments. The legislation specifically prohibits governmental units from entering into certain contracts “unless the contractor and the contractor’s subcontractors comply with the requirements of Article 2 of Chapter 64 of the General Statutes.” (Article 2 of Chapter 64 establishes North Carolina’s E-Verify requirements for private employers). It is important to note that the verification requirement applies to subcontractors as well as contractors. The new laws specifically prohibit governmental units from entering into contracts with contractors who have not (or their subs have not) complied with E-Verify requirements. Complete the attached affidavit, and include it with your submittal. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Bid Page #3 Attachment A RFP# 367-OC5324 Bid Proposal Form: Orange County Motor Pool Roof Replacement Contractor agrees to furnish all materials, labor, equipment and any other supplies necessary to complete the above work, for the sum of: (Complete detailed breakout below) Part A: Motor Pool Roof Replacement Base Bid: $___________________________________________________________________ Alternate 1: Install and mechanically fasten a layer of nail base insulation (rigid insulation with factory adhered plywood substrate) directly over existing OSB. $______________________________________ Provide unit prices for the estimated quantities for each item below as defined in Section 012100, Paragraph 1.03A of the Project Manual, shall be considered to have already been included within the base bid amount proposed above. The unit prices provided below shall be applied as appropriate, to compute the total value of changes in the scope of the work in the event that the quantity of actual work performed is more than or less than the estimated quantity. Unit prices quoted and accepted shall apply throughout the life of the contract, except as otherwise specifically noted.  All work must be completed within 75 days of the project start date (approx.)  Contractor is willing to participate in the County’s “Docusign” digital contracting process and enter into a standard contract with the County. ___________________________________________________ _________________ (Signature of Contractor) (Date) Acknowledge Addenda below: No. 1 _________ No. 2__________ No3.____________ Orange County Forms: 1. Form of Proposal 2. E-Verify Affidavit and Living Wage 3. Construction Contract Template 4. Nondiscrimination Certification 5. Dispute Resolution Unit Prices Description Section No. Unit Unit Price 1 Wood Blocking Replacement 061000 BD FT $ 2 Oriented Strand Board Replacement 061000 SQ FT 3 Supplemental Fastening of OSB 073110 PER 100 4 Exterior Sheathing Replacement 073110 SQ FT 5 Tectum E Plank Replacement 061000 EA DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Bid Page #4 6. Minimum Insurance Requirements 7. County Sales Use Tax Forms 8. Drawings & Specifications 9. Orange County Hot Work Permit Process The highlighted forms shall be returned as a part of your bid package. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E STATE OF NORTH CAROLINA AFFIDAVIT ORANGE COUNTY ************************** I, ____________________________(the individual attesting below), being duly authorized by and on behalf of ________________________________ (the entity bidding on project hereinafter "Employer") after first being duly sworn hereby swears or affirms as follows: 1. Employer understands that E-Verify is the federal E-Verify program operated by the United States Department of Homeland Security and other federal agencies, or any successor or equivalent program used to verify the work authorization of newly hired employees pursuant to federal law in accordance with NCGS §64-25(5). 2. Employer understands that Employers Must Use E-Verify. Each employer, after hiring an employee to work in the United States, shall verify the work authorization of the employee through E-Verify in accordance with NCGS§64-26(a). 3. Employer is a person, business entity, or other organization that transacts business in this State and that employs 25 or more employees in this State. (mark Yes or No) a. YES _____, or b. NO _____ 4. Employer's subcontractors comply with E-Verify, and if Employer is the winning bidder on this project Employer will ensure compliance with E-Verify by any subcontractors subsequently hired by Employer. This ____ day of _______________, 201_. Signature of Affiant Print or Type Name: _________________________ State of North Carolina, _________ County Signed and sworn to (or affirmed) before me, this the _____ day of ________________, 20__. My Commission Expires: Notary Public (Affix Official/Notarial Seal) DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Section I: General Government and Administration Policy 10.0: Living Wage Contractor Policy Reviewed by: County Attorney/County Manager Approved by: County Manager Original Effective Date: July 1, 2017 Revisions: Policy Statement It is the policy of Orange County to ensure its employees, and all individuals who provide services for Orange County, are paid a living wage. Purpose To encourage all vendors and contractors to pay a living wage to all employees who perform work pursuant to a contract with Orange County. Applicability Applies to all Orange County contracts and purchases. Policy 10.1 Living Wage 10.1.1 Orange County is committed to providing its employees with a living wage and encourages all contractors and vendors doing business with Orange County to pursue the same goal. Orange County’s living wage is $14.95 per hour. To the extent possible, Orange County recommends that contractors and vendors seeking to do business with Orange County provide a living wage to their employees. 10.1.2 Prior to final execution of a contract with Orange County all contractors and vendors seeking to do business with Orange County shall submit to the County’s representative a statement indicating whether those employees who will perform work on the Orange County contract are paid at least the living wage amount set out above. If such employees do not make at least the living wage amount set out above the contractor or vendor shall indicate in the statement the actual amount paid to such employees. For bid projects this statement should be submitted as part of the bid packet. This policy may be reviewed annually and updated as needed by the Manager’s Office Acknowledged Receipt by: ____________________________________ Company Name: ____________________________________________ Date: _____________________________________________________ DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 1 [Departmental Use Only] TITLE Motor Pool Roof Replacement FY 2021-2022 NORTH CAROLINA CONSTRUCTION AGREEMENT UNDER $250,000.00 ORANGE COUNTY THIS CONSTRUCTION AGREEMENT (hereinafter called “Agreement”), made as of the day of , 20 , by and between , (hereinafter called the “Contractor”), and Orange County, a political subdivision of the State of North Carolina, (hereinafter called the “County,” “Orange County,” or “Owner”). W I T N E S S E T H: That the Contractor and the Owner, for the consideration herein named, agree as follows: 1. CONTRACT DOCUMENTS; PRIORITY The Contract Documents consist of this Agreement, the Request for Proposals, Proposal, Construction Drawings, and Written Specifications. The Contract Documents form the Contract. In the event of any inconsistency between or among the Contract Documents the Contract Documents shall be interpreted in the following order of priority: a. This Agreement. b. Designer Approved Bulletins and Field Orders. c. Request for Proposals and addenda thereto. d. Proposal. 2. SCOPE OF WORK The Contractor shall furnish and deliver all of the materials, and perform all of the work required by this Agreement within the time period stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner and in accordance with the following enumerated documents, which are made a part hereof as if fully contained herein: a. Construction Drawings prepared by Atlas Engineering, Inc (Sheet COV, 1.0, 2.0, 2.1, 2.2, 2.3, 3.1, 3.2, 3.3 dated 08/09/2021) b. Written specifications prepared by the project engineer. c. proposal dated , 20 which fully describes the work to be performed. Such work will hereafter be called the “Work”. d. Related documents listed under Section 1 above. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 2 3. TERM AND SCHEDULING a. The Contractor agrees to commence work pursuant to the written Notice to Proceed. b. The Contractor agrees to complete substantially all Work by , 2021 or 75 calendar days from the date of the Notice to Proceed. c. Time is of the essence with respect to all dates specified in the Contract Documents as Completion Dates. d. The Contractor shall perform the Work in the time, manner, and form required by the Contract Documents and as stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner. e. It is expressly understood that the Owner will employ other contractors to perform work as a part of the Project whose work will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate its activities with such other contractors, particularly with respect to access to work areas, storage of materials and other common facilities. f. Should the Owner determine that the Contractor is behind schedule Owner may require, at no additional cost to the Owner, the Contractor to expedite and accelerate its efforts, including providing additional resources and working overtime, as necessary, to perform the Work in accordance with the approved project schedule. 4. STANDARD OF CARE a. The Contractor shall exercise reasonable care and diligence in performing the Work in accordance with the highest generally accepted standards of this type of Contractor practice throughout the United States and in accordance with applicable federal, state and local laws and regulations applicable to the performance of these services. Contractor is solely responsible for the professional quality, accuracy and timely completion and submission of all work. b. The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance or configuration. c. Contractor shall be responsible for all errors or omissions caused by its employees, agents, contractors, or assigns in the performance of the Agreement. Contractor shall correct any and all errors, omissions, discrepancies, ambiguities, mistakes or conflicts at no additional cost to the Owner. d. Contractor is an independent contractor of Owner. Any and all employees of the Contractor engaged by the Contractor in the performance of any work or services required of the Contractor under this Agreement, shall be considered employees or agents of the Contractor only and not of the Owner, and any and all claims that may or might arise under any workers compensation or other law or contract on behalf of said employees while so engaged shall be the sole obligation and responsibility of the Contractor. e. If activities related to the performance of this Agreement require specific licenses, DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 3 certifications, or related credentials Contractor represents that it or its employees, agents and subcontractors engaged in such activities possess such licenses, certifications, or credentials and that such licenses certifications, or credentials are current, active, and not in a state of suspension or revocation. f. The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor and Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, or control, and all such property while it is in transit. g. The Contractor is solely responsible for obtaining all permits necessary to complete the Work in compliance with all local, state, and federal laws. 5. PAYMENT & TAXES a. The Owner hereby agrees to pay to the Contractor for the faithful performance of this Agreement, and the Contractor hereby agrees to perform all of the Work for a sum not-to- exceed Dollars ($ ). Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Owner’s Representative, generally the architect if an architect is retained on the Work, a Request for Payment for work done during the previous calendar month. i. The Request for Payment shall be in form of a standardized invoice or AIA Document G702-703 appropriately addressed to Owner’s Representative at 551-A Pylon Drive, Raleigh, NC 27606 (Atlas Job # J2400) and shall show substantially the value of work done during the previous calendar month. ii. The amount due for payment shall be ninety-five percent (95%) of the value of work completed since the last Request for Payment and this amount shall be paid by the Owner on or before the last business day of the month. Owner shall retain five percent (5%). 1. Upon Owner’s Representative’s certification that ninety percent (90%) of the Work has been satisfactorily completed retainage may be discontinued. Retainage may be discontinued, at Owner’s Discretion, so long as work continues to be completed satisfactorily and on schedule. iii. Final payment shall not be due to the Contractor until thirty (30) days after one hundred percent (100%) of the Work, including punch list work, has been satisfactorily (as determined by the County) completed and an appropriate affidavit as required in Section 7(c) below has been received by Owner. b. Should Owner reasonably determine that Contractor has failed to perform the Work related to a Request for Payment, Owner, at its discretion may provide the Contractor ten (10) days to cure the breach. Owner may withhold the accompanying payment without penalty until such time as Contractor cures the breach. i. Should Contractor or its representatives fail to cure the breach within ten (10) days, or fail to reasonably agree to such modified schedule, Owner may immediately terminate this Agreement in writing, without penalty or incurring further obligation to Contractor. ii. This section shall not be interpreted to limit the definition of breach to the failure to perform the Work related to a Request for Payment. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 4 c. The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. It shall be the Contractor's responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of its subcontractors. 6. INSURANCE AND BONDS a. Minimum requirements – Contractor shall obtain, at its sole expense, Commercial General Liability Insurance, Automobile Insurance, Workers’ Compensation Insurance, and any additional insurance as may be required by Owner’s Risk Manager as such insurance requirements are described in the Orange County Risk Transfer Policy and Orange County Minimum Insurance Coverage Requirements (each document is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). If Owner’s Risk Manager determines additional insurance coverage is required such additional insurance shall be designated here N/A (if no additional insurance required mark N/A as being not applicable). Contractor shall not commence construction work until such insurance is in effect and certification thereof has been received by the Owner's Risk Manager. b. Performance Bonds – Contractor shall furnish bonds covering the faithful performance of the Contract and payment of all obligations arising under any of the Contract Documents or related in any way to the Work. Contractor shall immediately furnish a copy of such bonds to any requesting person who appears to be a potential beneficiary of bonds covering payment obligations arising under any of the Contract Documents. This subsection 6(b) applies only to Contracts of fifty thousand dollars ($50,000.00) or more where the total cost for the project is three hundred thousand dollars ($300,000.00) or more. 7. INDEMNITY a. To the extent authorized by North Carolina law the Contractor shall indemnify, without limitation, and hold harmless to the maximum extent permitted by law the Owner and its agents and employees from and against any and all claims, damages, losses and expenses, including attorney's fees, arising out of or resulting from the performance or nonperformance of the Work, provided that any such claim, damages, loss or expense (A) is attributable to bodily injury, sickness, disease or death or injury to, or destruction of, property, including the loss of use resulting therefrom; and (B) is caused in whole or in part by any breach of any provision of the Agreement or by any negligent or wrongful act or omission of the Contractor, any Subcontractor, or supplier of the Contractor, anyone directly or indirectly employed by any of them or anyone for whose acts any of them may be liable. The indemnification obligation under this paragraph shall not be limited in any way by any limitation of the amount or type of damages, compensation or benefits payable by or for the Contractor or any subcontractor under workers' compensation acts, disability benefits acts or other employee benefit acts. It is the intent of this section that the Contractor shall indemnify the County to the maximum extent allowed by law. b. The Contractor shall indemnify and hold harmless Owner from any lien of whatever type through the purchase of appropriate bonds and insurance as designated in Section 6 above. In the event any such lien is filed against Owner’s property Contractor shall, through such DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 5 bonds and insurance or at Contractors expense, defend Owner against all such claims of lien. c. Upon completion of the Work the Contractor shall execute an affidavit stating there are no unpaid debts for any work that has been done or materials that have been furnished to the project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such debts and liens. Such indemnification shall be in a form and substance acceptable to Owner. d. By executing this Agreement Contractor agrees to abide by and be bound by the indemnification provisions herein and of Section 7(c) specifically. 8. DISPUTE RESOLUTION AND GOVERNING LAW a. Any dispute with respect to any provision of, or the performance or non-performance of, this Agreement shall be subject to the Dispute Resolution Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). b. The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement or the Contract shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. c. Notice of any claim by Owner or Contractor must be initiated by written notice to the other Party within thirty (30) days of the occurrence of the event giving rise to the claim or within thirty (30) days of the discovery of the event or condition giving rise to the claim, whichever is later. i. Should any claim be made, regardless of whether such claim is made by Owner or Contractor, Contractor shall continue to faithfully and diligently perform the Work in such a manner as to meet all scheduled timelines. Any failure to faithfully and diligently perform the Work may be deemed, by the Owner, a breach of the Contract. ii. If a claim is made such claim shall be made to the initial decision maker, if applicable, who may request more supporting data, reject the claim in whole or in part, approve the claim in whole or in part or advise the parties the claim is unable to be resolved. iii. If a claim is made by the Owner the Owner may, but is not obligated to, notify the surety. 9. NON–APPROPRIATION a. Contractor acknowledges that Owner is a governmental entity, and the validity of this Agreement is based upon the availability of public funding under the authority of its statutory mandate. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 6 b. In the event that public funds are unavailable or not appropriated for the performance of Owner’s obligations under this Agreement, then this Agreement shall automatically expire without penalty to Owner immediately upon written notice to Contractor of the unavailability or non-appropriation of public funds. It is expressly agreed that Owner shall not activate this non-appropriation provision for its convenience or to circumvent the requirements of this Agreement. c. In the event of a change in the Owner’s statutory authority, mandate or mandated functions, by state or federal legislative or regulatory action, which adversely affects Owner’s authority to continue its obligations under this Agreement, then this Agreement shall automatically terminate without penalty to Owner upon written notice to Contractor of such limitation or change in Owner’s legal authority. 10. NOTICES Any notice required by this Agreement shall be in writing and delivered by certified or registered mail, return receipt requested to the following: Owner: Contractor: Orange County Attn: A. Barnes P.O. Box 8181 Hillsborough, NC 27278 11. MISCELLANEOUS a. Duties and Obligations imposed by the Contract Documents shall be in addition to any Duties and Obligations imposed by state, federal or local law, rules, regulations and ordinances. b. No act or failure to act by the Owner or Contractor shall constitute a waiver of any right or duty granted them under the Contract Documents, nor shall any act or failure to act constitute any approval except as specifically agreed in writing. c. The Work shall be tested and inspected as required by the Contract Documents and as required by law. Unless prohibited by law the costs of all such tests and inspections related to state and federal codes such as ADA, Administrative, Electrical, Plumbing, Mechanical and Building Codes shall be borne by the Contractor. The costs for material and structural testing shall be conducted by an independent third party at the expense of the Owner. Delays related to any of the aforementioned tests and inspections shall not be grounds for delaying the completion of the work. If any such tests and inspections reveal deficiencies in the Work such that the Work does not comply with terms or requirements of the Contract Documents and the requirements of any code or law the Contractor is solely responsible for the cost of bringing such deficiencies into compliance with the terms of the Contract Documents and any code or law. d. Should the Architect, if an architect is retained for the project involving the Work, or Owner reject any portion of the Work for failing to comply with the Contract Documents Contractor shall immediately, at Contractor’s expense, correct the Work. Any such rejection may be made before or after substantial completion. If applicable, any additional DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 7 expense borne by the Architect under this section shall be paid at Contractor’s expense. e. The Contractor shall not assign any portion of this Agreement nor subcontract the Work in its entirety without the prior written consent of the Owner. f. By executing this Agreement Contractor affirms that Contractor and any subcontractors of Contractor are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. g. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. h. By executing this Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. i. The County has designated (Angel Barnes) to act as the County's representative with respect to the Work and shall have the authority to render decisions within guidelines established by the County Manager or the County Board of Commissioners and shall be available during working hours as often as may be reasonably required to render decisions and to furnish information. j. Contractor shall at all times remain in compliance with all applicable local, state, and federal laws, rules, and regulations including but not limited to all state and federal non- discrimination laws, policies, rules, and regulations and the Orange County Non- Discrimination Policy and Orange County Living Wage Policy (each policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Any violation of the Orange County Non-Discrimination Policy is a breach of this Agreement and County may immediately terminate this Agreement without further obligation on the part of the County. This paragraph is not intended to limit and does not limit the definition of breach to discrimination. k. This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. l. In the event of a breach by Contractor Owner has sole authority to determine the reasonableness of Contractor’s actions to remedy such breach or complete the performance of its obligations. m. Upon request of the Owner, the Contractor shall submit to County all relevant documentation, including but not limited to, job cost records, to support its claims for final compensation and if such request is made final compensation shall not be due until all relevant documentation is received, reviewed, and approved by Owner. 12. CONSEQUENTIAL AND LIQUIDATED DAMAGES DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 8 a. Owner and Contractor mutually waive any claim against each other for consequential damages. Consequential Damages include: i. Damages incurred by Owner for loss of use, income, financing, or business. ii. Damages incurred by Contractor for office expenses, including personnel, loss of financing, profit, income, business, damage to reputation, or any other non-direct damages. b. Liquidated damages shall be in accord with the Contract Documents. If the Contract Documents do not otherwise address liquidated damages, such damages shall be in the amount of five hundred dollars ($500.00) per day. 13. TERMINATION OR SUSPENSION a. The Owner may, without cause, order the Contractor to terminate, suspend, delay or interrupt the Work in whole or in part for such period of time as the Owner may determine. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is not due to or as a result of any fault on the part of the Contr actor or any subcontractor, the Contractor may recover a per diem amount of five hundred dollars ($500.00) per day with a not-to-exceed limit of ten thousand dollars ($10,000.00). ii. In the event of termination by the Owner under this Agreement, the Contractor shall be entitled to receive its reasonable and documented direct costs prior to termination, including the cost of materials purchased for the Work which purchases cannot be canceled or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the work in a safe and efficient manner. iii. If Owner elects to suspend or terminate the contract pursuant to subparagraphs 13.a.i. or 13 a.ii. the sole remedy available to the Contractor are those listed in the subparagraphs and Contractor is not entitled to any right to further claims for any amount owed or disputed or for payment of damages alleged to have been sustained as a result of Owner’s order to delay, suspend, or interrupt the Work. b. The Owner may, with cause, order the Contractor to suspend, delay or interrupt the Work in whole or in part for such period of time as the cause remains. i. If Owner issues a written order to delay, suspend, or interrupt the Work, and such order is due to or as a result of any fault on the part of the Contractor or any subcontractor, the Owner may reduce payment at a per diem amount of five hundred dollars ($500.00) per day. c. Contractor may terminate the Contract if, at the Owner’s written direction, the Work is stopped for twenty one (21) consecutive days through no act or fault of the Contractor, their agents or employees, or a subcontractor or their agents or employees or any other person performing work pursuant to the Contract Documents. Contractor may terminate the Contract if a Court or other Public authority having jurisdiction enters a lawful order DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 9 that requires all work to be stopped and such stoppage lasts for twenty one (21) consecutive days. d. Either party may terminate this Agreement upon notice to the other party that obligations pursuant to this Agreement are made impossible due to declarations of emergency by Orange County or by North Carolina due to events directly impacting Orange County. Both parties shall remain responsible for all payment and performance due up to the receipt of such notice, but shall have no further obligation or responsibility beyond that date provided the terminating party has taken all reasonable steps to complete the performance of its obligations. 14. ENTIRE AGREEMENT All of the documents listed, referenced or described in this Agreement, the written Notice-to- Proceed, together with Modifications made or issued in accordance herewith are the Contract Documents, and the work, labor, materials and completed construction required by the Contract Documents and all parts thereof is the Work. The Contract Documents constitute the entire agreement between Owner and Contractor. This Agreement may be amended only by written instrument signed by both parties. Modifications may be evidenced by facsimile signatures. If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. IN WITNESS WHEREOF, the Parties hereto have executed this Agreement as of the day and date first above written wholly or in a number of counterparts each of which shall, without proof or accounting for other counterparts, be deemed an original contract. ORANGE COUNTY CONTRACTOR ____________________________________ ________________________________________ Signature Signature County Manager ________________________________________ Printed Name and Title DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 06/21 10 ORANGE COUNTY—DEPARTMENT USE ONLY ______________________________________________________________________________ Party/Vendor Name: Party/Vendor Contact Person: Contact Phone: Party/Vendor Address: City State: Zip: Department: Amount: Purpose: Budget Code(s): Vendor # (N/A if new vendor) Vendor is a BOCC consultant? Yes No Contract Type: (Check one) New Renewal Amendment Effective Date Approved by Board Yes No Agenda Date: --- For Section XIV. c. contracts only, Approved by Board in Current FY Budget Yes No This agreement is approved as to technical form and content and I as Department Director affirmatively state work on this project has not been initiated prior to execution of the agreement: Department Director’s Signature ________________________________________ Date: ________ Agreements for emergency services or repair are not subject to the above affirmation. If services related to this agreement have already begun or been completed please briefly describe the nature of the emergency condition that was addressed: Risk Management This agreement is approved for sufficiency of insurance standards, specifications, and requirements: Office of the Risk Management Officer___________________________________ Date: _________ Financial Services This instrument has been pre-audited in the manner required by the Local Government Budget and Fiscal Control Act: Office of the Chief Financial Officer ____________________________________ Date: _________ Legal Services This agreement is approved as to legal form and sufficiency: Office of the County Attorney __________________________________________Date: ________ Clerk to the Board Received for record retention: All Docusign contracts must be copied to the Clerk upon completion: occlerkdocs@orangecountync.gov The following signature block is for hard copies only and is not required for Docusign contracts: Office of the Clerk to the Board __________________________________________Date:_________ DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ORANGE COUNTY NONDISCRIMINATION CERTIFICATION The undersigned bidder or proposer hereby certifies and agrees that the following information is correct: 1. In preparing its enclosed bid or proposal, the undersigned bidder or proposer has considered all bids and proposals submitted from qualified, potential subcontractors and suppliers, and has not engaged in discrimination as defined in Section 12 -52 of the Orange County Non-discrimination Ordinance. 2. Without limiting any other remedies that Orange Co unty may have for a false certification, it is understood and agreed that, if this certification is false, such false certification will constitute grounds for Orange County to reject the bid or proposal submitted with this certification, and terminate any contract awarded based on such bid or proposal. It shall also subject the bidder or proposer to disqualification from participating in county contracts or bid processes for up to two years. 3. As a condition of contracting with Orange County, the undersigned bidder or proposer agrees to promptly provide to Orange County all information and documentation that may be requested by Orange County from time to time regarding the solicitation and selection of suppliers and subcontractors in connection with this solicitation process. Failure to maintain or failure to provide such information constitutes grounds for Orange County to reject the bid or proposal and to terminate, without penalty to Orange County, any contract awarded on such bid or proposal. All such information and documentation shall be maintained for a period of three years after the expiration of the contract. 4. As part of its bid or proposal, the undersigned bidder or proposer shall provide to Orange County a list of all instances within the past ten years where a complaint was filed or pending against bidder or proposer in a legal or administrative proceeding alleging that bidder or proposer discriminated against its subcontractors, vendors, suppliers, or commercial customers, and a description of the status or resolution of that complaint, including any remedial action taken. 5. As a condition of submitting a bid or proposal to Orange County the undersigned bidder or proposer agrees to comply with the Orange County Non-discrimination Ordinance. Falsification of this certification shall constitute a violation of the Orange DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E County Non-Discrimination Ordinance and shall be grounds for rejection of the bid or proposal or termination of an existing contract, without fault or further obligation to Orange County. 6. As a condition of submitting a bid or proposal to Orange County the undersigned bidder or proposer agrees that Orange County may consider the information submitted as part of this certification in its determination of the responsibility of the undersigned bidder or proposer. The undersigned bidder or proposer, as the case may be, waives the right to challenge the rejection of a bid or proposal when such rejection is based, in its entirety, on information submitted as part of this certification. The bidder or proposer certifies the undersigned has full authority to sign on its behalf. By:________________________________________ ___________________________________________ Printed Name and Title On behalf of _________________________________ ___________________________________________ Company or Corporate name Date: ______________________________________ DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 07/20 ORANGE COUNTY NORTH CAROLINA DISPUTE RESOLUTION RULES AND PROCEDURES FOR ORANGE COUNTY DESIGN, BUILDING CONSTRUCTION, RENOVATION, AND REPAIR PROJECTS RULE 1. INITIATING MEDIATED SETTLEMENT CONFERENCES A. Purpose of Mandatory Settlement Conferences. Pursuant to G.S. §143-128(f1) and 143- 135.26(11), these Rules are promulgated to implement a mediated settlement program designed to focus the parties’ attention on settlement rather than on claim preparation and to provide an opportunity for orderly settlement negotiations to take place. Nothing herein is intended to limit or prevent the parties from engaging in settlement procedures voluntarily at any time prior to or during commencement of the dispute resolution process. B. Initiating the Dispute Resolution Process 1. Any party to a County public construction contract (referred to herein generally as the “Contract”) governed by Article 8. Ch. 143 of the General Statutes and identified in G.S. § 143- 128(f1) and who is a party to a dispute arising out of the Contract and the construction process in which the amount in controversy is at least $15,000 may submit a written request to the County for mediation of the dispute. 2. Prior to submission of a written request for mediation to the County, the party requesting mediation should give notice of any and all claims in accordance with their respective contracts, obtain decisions on the claims as required or allowed by their respective contracts, and attempt to resolve the dispute according to the terms and conditions in their respective contracts. The Mediator may adjourn any mediated settlement conference if the Mediator believes, in his or her sole discretion, that the parties have not satisfied all of the terms and conditions of their respective contracts and that doing so will enhance the prospects for a negotiated settlement. C. Condition Precedent to Litigation. Before any party to a Contract may commence a civil action against the County seeking remedies for breach or non-performance of the Contract by the County, said party must first initiate the dispute resolution process under these rules and attend and participate in good faith in the mediated settlement conference. RULE 2. SELECTION OF MEDIATOR A. Mediator Listing. A List of Mediators acceptable to the County is maintained by the County Attorney and that list is incorporated by reference into these Rules. B. Selection of Mediator. The party requesting mediation shall select a Mediator from the List of Mediators and shall file, with the County, a Notice of Selection of Mediator within 21 days of the request for mediation. Such notice shall state the name, address, and phone number of the Mediator selected. If DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 07/20 the Mediator selected is not available or declines to participate for any reason, the requesting party shall select another person from the List of Mediators. If the party requesting mediation does not select and designate a mediator within 21 days of the request for mediation, the County shall have the right in its absolute discretion to appoint a mediator from its List of Mediators. C. Disqualification of Mediator. Any party may request replacement of the Mediator for good cause. Nothing in this provision shall preclude Mediators from disqualifying themselves. RULE 3. THE MEDIATED SETTLEMENT CONFERENCE A. Where Conference is to be Held. Unless all parties and the Mediator otherwise agree, the mediated settlement conference shall be held in county seat of Orange County. The Mediator shall be responsible for reserving a place, making arrangements for the conference, and giving timely notice of the time and location of the conference to all attorneys, unrepresented parties and other persons or entities required to attend. B. When Conference is to be Held. The mediation shall be completed within 90 days after selection of the Mediator unless all parties to the mediation agree to a different schedule. C. Request to Accelerate or Extend Deadline for Completion. Any party or the Mediator may request the County to accelerate or extend the deadline for completion of the conference. Such request shall state the reasons the acceleration or extension is sought and shall be served by the moving party upon the other parties and the Mediator. Objections to the request must be promptly communicated to the County and to the Mediator. The County, with the concurrence of the designated Mediator, may grant the request by adjusting the time for completion of the conference. D. Recesses. The Mediator may recess the mediation conference at any time and may set times for reconvening. If the Mediator determines the time and place where the conference is to reconvene before the conference is recessed, no further notice is required to persons present at the conference. E. Project Delay. The mediated settlement conference that results from a construction contract dispute shall not be cause for the delay of the construction project. RULE 4. DUTIES OF PARTIES AND OTHER PARTICIPANTS IN FORMAL DISPUTE RESOLUTION PROCESS A. Attendance. 1. All parties to the dispute must designate an official representative to attend the mediation. 2. “Attendance” means physical attendance, not by telephone or other electronic means. Any attendee representing a party must have authority from that party to bind it to any agreement reached as a result of the mediation. 3. Attorneys representing parties may attend the mediation, but are not required to do so. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 07/20 4. Sureties and insurance company representatives are required to physically attend the mediation unless the Mediator and all of the other parties to the mediation excuse their attendance or consent to their attendance by telephone or other electronic means. 5. The parties who attend a duly scheduled mediation conference shall have the right to recover their share of the Mediator’s compensation from any party or parties who fail to attend the conference without good cause. B. Finalizing Agreement. If an agreement is reached in the conference, the terms of the agreement shall be confirmed in writing and signed by all parties. C. Payment of Mediation Fee: Mediation Fees charged by the Mediator shall be paid in accordance with G.S. § 143-128(f1). D. Failure to Compensate Mediator. Any party’s failure to compensate the Mediators in accordance with G.S. § 143-128(f1) shall subject that party to a withholding by the County of said amount of money from the party’s payment or any other moneys owed by that party to the County. Should the County fail to compensate the Mediator, it shall hereby be subject to a civil cause of action from the Mediator for the County’s portion of the Mediator’s total fee as required by G.S. § 143-128(f1). RULE 5. AUTHORITY AND DUTIES OF MEDIATORS A. Authority of Mediator. 1.Control of Conference. The Mediator shall at all times be in control of the conference and the procedures to be followed. 2.Private Consultation. The Mediator may communicate privately with any participant or counsel prior to and during the conference. The fact that private communications have occurred with a participant shall be disclosed to all other participants at the beginning of the conference. 3.Scheduling the Conference. The Mediator shall make a good faith effort to schedule the conference at a time that is convenient with the participants, attorneys and Mediator. In the absence of agreement, the Mediator shall select the date for the conference. 4.Determining good cause for a party’s failure to appear at a scheduled mediation conference. B.Duties of Mediator. 1.The Mediator shall define and describe the following at the beginning of the conference: a.The process of mediation. b.The difference between mediation and other forms of conflict resolution. c.The costs of the mediated settlement conference. d.That the mediated settlement conference is not a trial, the Mediator is not a judge, and the parties retain their legal rights if they do not reach settlement; however, the DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 07/20 Mediator will advise all parties that failure to appear at mediation without good cause may result in imposition of sanctions and may be asserted as a bar to lawsuits by claimants who have failed to exhaust this administrative remedy. e.The circumstances under which the Mediator may meet and communicate privately with any of the parties or with any other person. f.Whether and under what conditions communications with the Mediator will be held in confidence during the conference. g.The inadmissibility of conduct and statements as provided by G.S. §7A-38.1(1). h.The duties and responsibilities of the Mediator and the participants. i.That any agreement reached will be reached by mutual consent. 2. Disclosure: The Mediator has a duty to be impartial and to advise all participants of any possible bias, prejudice or partiality. 3. Declaring Impasse: The Mediator may determine at any time during the mediation conference that an impasse exists and that the conference should end. 4. Reporting Results of Conference. The Mediator shall submit a written report to the County and the other parties within 10 days of the conference stating whether or not the parties reached an agreement. The Mediator’s report shall indicate the absence of any party from the mediated settlement conference without permission or good cause. 5. Scheduling and Holding the Conference. It is the duty of the Mediator to schedule the conference and conduct it prior to the deadline of completion set by the rules. The Mediator shall strictly observe deadlines for completion of the conference unless said time limit is changed by agreement of the parties. RULE 6. COMPENSATION OF THE MEDIATOR The parties shall compensate the Mediator for mediation services at the rate proposed by the Mediator and agreed to by the parties at the time the Mediator is selected. RULE 7. RULE MAKING These Rules may be amended by the County at any time. Amendments will not affect mediations where claims or requests for mediation have been filed at the time the amendment takes effect . RULE 8. DEFINITIONS A. “County” shall mean Orange County North Carolina. B. “Project Designer” is that person or firm stipulated as project designer in the Contract Documents for the project. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Revised 07/20 C. “Claim” is a demand or assertion by a party seeking adjustment or interpretation of Contract terms, payment of money, extension of time or other relief with respect to the terms of the Contract. The term “Claim” also includes other disputes and matters in question between the parties to a Contract involved in the County’s building construction renovation and repair projects arising out of or relating to the Contract or the construction process. Claims must be initiated by a written notice. The responsibility to substantiate Claims shall rest with the party making the Claim. D. “Good Cause” generally includes any circumstance beyond the control of a party, which prevents that party from meeting obligations. When good cause is asserted as an excuse for a party’s failure to appear at a mediation conference or to otherwise comply with the requirements of these Rules, the Mediator, in his or her sole discretion, will determine whether good cause exists to excuse the party’s failure to appear or otherwise comply with these rules. RULE 9. TIME LIMITS A. Any time limit provided for by these Rules may be waived or extended at the sole discretion of the County, if no Mediator has been selected, and at the discretion of the County with concurrence of the Mediator if a Mediator has been selected. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. Coverage Low Risk Profile Standard Risk Profile High Risk Profile Specialty Encroachment Premises Lease Commercial General Liability Products/Completed Operation Explosion, Collapse & Underground (XCU) $1,000,000/$2,000,000 Per accident As above $1,000,000/$2,000,000 As Above If any, Limit to be determined. $1,000,000/$2,000,000 As above If any, TBD. $1,000,000* As Above If any, TBD. $1,000,000 $1,000,000 Automobile Liability $1,000,000 (CSL) Per occurrence $1,000,000* $1,000,000* $1,000,000* N/A N/A **Workers’ Compensation Statutory Statutory Statutory Statutory N/A Statutory **Employer’s Liability 100/500/100 500/500/500* 500/500/500 500/500/500* N/A 100/500/100 ** Waiver of Subrogation on WC Required if available Required if available Required Required N/A N/A Umbrella Liability $1,000,000 $2,000,000 $2,000,000+ $9,000,000+ N/A N/A Professional Liability may be required on a risk profile depending on nature of services provided by contract. Coverage required for professional service such as accountant, attorney, architect, design, engineering, health care and most consultants. $1,000,000 per occurrence $1,000,000 TBD TBD N/A N/A Sexual Misconduct (Sexual Abuse/Molestation) may be required for contractors working directly one-on-one with children and elderly or in overnight sheltering capacities. $1,000,000/$2,000,000 $1,000,000/$2,000,000 TBD TBD N/A TBD Cyber Liability may be required for contractors having access to personal identifying information, and/or computer networks. $1,000,000/$2,000,000 TBD TBD TBD N/A Environmental/Pollution Liability required if demolition, use of N/A $1,000,000 $1,000,000+* $1,000,000+* N/A N/A DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. hazardous material or environmentally sensitive Fidelity Bond (loss of money or other property due to dishonest acts). Only for contracts such as Banking, Janitorial, Fundraising, TPA’s and similar, ETA TBD Amount depends on exposure to loss TBD TBD N/A N/A Other Coverage As required TBD TBD TBD TBD N/A N/A Bid, Performance & Payment Bonds TBD TBD TBD TBD N/A N/A *A combination of Umbrella/Excess and primary limit may be used to provide coverage for the amount shown. ** Workers’ Compensation is required if the contractor/vendor has employees. Owner Waiver is acceptable for a Sole Proprietor. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E STATE OF NORTH CAROLINA COUNTY SALES AND USE TAX REPORT SUMMARY TOTALS AND CERTIFICATION CONTRACTOR: Page __1____ of ______ PROJECT: FOR PERIOD: TOTAL FOR COUNTY OF: TOTAL FOR COUNTY OF: TOTAL FOR COUNTY OF: TOTAL FOR COUNTY OF: TOTAL FOR COUNTY OF: TOTAL FOR COUNTY OF: TOTAL ALL COUNTIES CONTRACTOR SUBCONTRACTOR(S)* COUNTY TOTAL * Attach subcontractor(s) report(s) ** Must balance with Detail Sheet(s) I certify that the above figures do not include any tax paid on supplies, tools and equipment which were used to perform this contract and only includes those building materials, supplies, fixtures and equipment which actually became a part of or annexed to th e building or structure. I certify that, to the best o f my knowledge, the information provided here is true, correct, and complete. Sworn to and subscribed before me, This the _______ day of _____________, 20____ Signed Notary Public My Commission Expires: Print or Type Name of Above Seal NOTE: This certified statement may be subject to audit. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E STATE OF NORTH CAROLINA SALES AND USE TAX REPORT DETAIL CONTRACTOR: Page ___2___ of ______ SUBCONTRACTOR FOR PERIOD: PROJECT: PURCHASE DATE VENDOR NAME INVOICE NUMBER TYPE OF PROPERTY INVOICE TOTAL COUNTY TAX PAID COUNTY OF SALE * $ $ TOTAL: $ * If this is an out-of-state vendor, the County of Sale should be the county to which the merchandise was shipped. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E MOTOR POOL MAIN BUILDING ROOF REPLACEMENT COVER SHEETNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.MOTOR POOL MAIN BUILDING ROOF REPLACEMENTORANGE COUNTYHILLSBOROUGH, NORTH CAROLINABUILDING CODE SUMMARY - 2018 APPENDIX BPREPARED FOR:ORANGE COUNTY ASSET MANAGEMENT300 W. TRYON STREET, B BLDG, 3RD FLOORHILLSBOROUGH, NC 27278SITE PLANNOT TO SCALEGENERAL LOCATION MAPNOT TO SCALEMOTOR POOLMAIN BUILDINGAS SHOWNKEWKEW/RTJ240008/09/2021COVBID DOCUMENTS/PERMIT SETREFER TO SHEET 1.0 FOR ADDITIONALNOTES REGARDING DESIGNATED SITESTAGING AND STORAGEMOTOR POOL MAIN BUILDING ROOF REPLACEMENTR-23.9 (MEETS 2009 NC ENERGY CODE PER HOUSE BILL 201)ASPHALT SHINGLES, UNDERLAYMENT, NAILBASE (34" PLYWOOD ANDPOLYISOCYANURATE INSULATION- 1" THICK), 7/16" OSB, 2.5" POLYISOCYANURATEINSULATION, 2" STRUCTURAL CEMENTITIOUS WOOD FIBER DECK.*(BID ALT. 01 VENTED NAILBASE INCLUDES AIR SPACE) (WIND UPLIFTS BASED ON HIGHEST ROOF AREA)0N/AROOF SYSTEM REPLACEMENT WILL NOT CHANGE THEEXISTING FIRE RATING OF THE OVERALL ROOFASSEMBLY602440N/AN/AN/AN/AN/AN/AN/AN/AN/AN/AXXXXNO CHANGE TO BUILDING AREAXNOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER THE ACCESSIBILITY OF THE EXISTING BUILDING OR PARKING LOTN/AN/ANOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER THE PLUMBING SYSTEM OF THE EXISTING BUILDINGNOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER THE LIFE SAFETY SYSTEM OR PLAN OF THE EXISTING BUILDINGTHE HEIGHT OF THE EXISTING BUILDINGNOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER NOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER THE AREA OF THE EXISTING BUILDINGGARAGE/OFFICES1996KELLI@ATLASNC.COMX151.001.00XXXN/AN/AN/AN/A9,000/9,500N/AN/AN/AN/AN/AN/AN/AB115200XX(919) 420-7676NC#28317KELLI WILCOXATLAS ENGINEERINGN/AKELLI WILCOX, PE, RRC, ATLAS ENGINEERING, INC.0.04XTHE ELECTRICAL SYSTEM OF THE EXISTING BUILDINGNOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER THE MECHANICAL SYSTEM OF THE EXISTING BUILDINGNOT-APPLICABLE: ROOF REPLACEMENT WILL NOT ALTER 00000N/AXABARNES@ORANGECOUNTYNC.GOV27278NO CHANGE IN USEN/AB- BUSINESS (OFFICES)PROJECT INCLUDES ROOF REPLACEMENT AND RAIN SCREEN INSTALLATION ONLYDRAWING INDEXCOV COVER SHEET AND BUILDING CODE SUMMARY1.0 ROOF PLAN AND BUILDING ELEVATIONS (PARTIAL)2.0 ROOF PLAN (ALT. 1) AND WIND UPLIFT ZONE2.1 CONSTRUCTION DETAILS2.2 CONSTRUCTION DETAILS2.3 CONSTRUCTION DETAILS3.1 CONSTRUCTION DETAILS3.2 CONSTRUCTION DETAILS3.3 CONSTRUCTION DETAILS9,000/9,5005'X5' (SLIGHT VARIATION ON MONOSLOPE AREAS)N/A10.40.91.11.0PROPOSED STORAGEAREA FOR DELIVEREDMATERIALS ANDEQUIPMENTPROPOSEDSTAGING AREAFOR DUMPSTERS,REMOVAL OF MATERIALAND LOADING OF NEWMATERIAL. (USE ONE SIDE AT A TIME. DONOT BLOCK DOORSOR DRIVE.600 HWY 86 NORTH, HILLSBOROUGH, NCORANGE COUNTYANGEL BARNES 919-245-2628NO CHANGEXXX(PLAN/ALONG SLOPE)ROOF AREAS NOTED ARE APPROXIMATE AND MUST BE FIELD VERIFIEDFOR THE PURPOSE OF BIDDING AND CONSTRUCTION9,000/9,5009,000/9,500SLOPED ROOF SNOWLOAD = FLAT ROOFSNOW LOAD FOR THISBUILDING5'HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICES DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E PRE-FINISHED DOWNSPOUT. SIZE, GENERAL PROFILE TO MATCHEXISTING. CONNECT TO GUTTER WITH OUTLET. SECURE WITH PRE-FINISHED STRAPS AT SAME LOCATIONS AS EXISTING. IF STRAP SPACINGEXCEEDS 8', INSTALL ADDITIONAL STRAPS AT CONSISTENT SPACING.DOWNSPOUT TO DISCHARGE IN SAME MANNER AS EXISTING(I.E. ONTO ADJACENT ROOF, ONTO GROUND)PRE-FINISHED GUTTER. SIZE AND GENERAL PROFILETO MATCH EXISTING. BACK LEG TO EXTEND A MIN. OF 1"HIGHER THAN OUTER LIP. SECURE THROUGH BACK LEG TOANGLE SUPPORT AND WALL PANEL WITH SCREWS @ 6" O.C.EVERY THIRD FASTENER WILL SECURE A GUTTER SPACER/STRAP (18"O.C.). FRONT EDGE OF GUTTER MUST BE AMIN. 1" BELOW THE ROOF EDGE.1"STARTER SHINGLE INSTALLED ALONG EAVE PRIOR TOFIRST COURSE OF SHINGLES. SECURE PER THEMANUFACTURER INSTALLATION REQUIREMENTS.ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL SMALL PIECE ALONGEAVE BEFORE DRIP EDGE. INSTALL ICE AND WATER SHIELD ALONG BOTTOM30" OF EAVE, OVERLAP TOP EDGE OF DRIP EDGE. INSTALL SYNTHETICUNDERLAYMENT OVER REST OF SURFACE, LAP OVER TOP EDGE OFICE AND WATER SHIELDEAVE ANGLE SUPPORT, SECURED TO DECK @ 12" O.C.EXISTING JOIST EXTENSIONSEXISTING CMU WALLEXISTING STEEL ANGLE/STOPAND PERIMETER WOOD BLOCKINGWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE NAILBASEMIN. 2" WIDE FLAT PLATE (OR ANGLE), CONTINUOUS, SECURED TOEACH HAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALLPANELS IF JOINTS DO NOT ALIGN WITH HAT CHANNELSPRE-FINISHED METAL WALL PANELS WITH CONCEALED FASTENERSAND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE (OR ANGLE), CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALL PANELS IFNOT ALIGNED WITH HAT CHANNELSPRE-FINISHED J-TRIMSECURED TO ANGLE @12" O.C.COLD-FORMED ANGLE,SECURED TO WALL@ 12" O.C. STAGGEREDREMOVE EXISTING COLD-FORMED FRAMING TOALLOW FOR INSTALLATIONOF NEW COMPONENTS.LOCATED NEW FRAMINGSO THAT SOFFIT WILL BELOCATED AT THE SAMEELEVATION UNLESSOTHERWISE APPROVEDBY THE DESIGNER.COLD-FORMED CHANNELOR ANGLE, AT EACH HATCHANNEL, SECURED TOANGLES WITH 2 FASTENERSPER CONNECTIONWALL BASE TRIM AND CLOSURE, SECURED TO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12" O.C.PRE-FINISHED VENTED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEINSTALL GUTTER GUARDSUPPORTED BY SPACERS/STRAP AND FASTENED TOOUTER LIP (NOT SHOWN)ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVEREDGE. INSTALL SYNTHETIC UNDERLAYMENT OVER REST OFSURFACE, LAP OVER TOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB ANDPERIMETER BLOCKING @ 12" O.C. TO PROPERLYPOSITION THE NAILBASEEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKEXISTING CMU WALL1" DEEP HAT CHANNELS SPACED @ 24" O.C.MAX. SECURE THROUGH EIFS AND SHEATHINGINTO EACH METAL STUDWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESNAILBASE, SECURE THROUGHTO OSB PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.CONTINUOUS CLEAT SECURED @ 12" O.C.CONTINUOUS CLEAT SECURED @ 12" O.C.WOOD BLOCKING, SECURE TO EXISTING BLOCKING@12" O.C. STAGGERED TO BRING BLOCKING FLUSHWITH THE NEW WALL PANELSEXISTING WOODBLOCKINGPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS. EXTEND PASTBOTTOM OF EIFS AND COVER CMU. BOTTOMELEVATION TO MATCH SOFFIT AT EAVEPRE-FINISHED FASCIA EXTENSION, SECURED @12" O.C. OVERLAP WALL PANEL BY 1.5" MIN.ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVER EDGETO COVER WOOD. INSTALL SYNTHETIC UNDERLAYMENT OVERREST OF SURFACE, LAP OVER TOP EDGE OF ICE AND WATERSHIELDWOOD BLOCKING. SECURE TO EXISTING OSBAND PERIMETER BLOCKING @ 12" O.C. TOPROPERLY POSITION THE NAILBASEEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSBPER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.CONTINUOUS CLEAT SECURED@ 12" O.C.PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOMELEVATION TO REMAIN CONSISTENTWITH DETAIL AT WALL PANELSCONTINUOUS CLEAT SECURED@ 12" O.C.WOOD BLOCKING TO MATCHFASCIA AT WALL PANELS, SECURETO EXISTING BLOCKING @12"O.C. STAGGEREDEXISTING CMU WALLWOOD BLOCKING TO MATCH BOTTOMOF FASCIA, SECURED @ 12" O.C.PRE-FINISHED CLOSURE METALASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSBPER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.EXISTINGWOODBLOCKINGEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.SELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVEREDGE. INSTALL SYNTHETIC UNDERLAYMENT OVER REST OFSURFACE, LAP OVER TOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB ANDPERIMETER BLOCKING @ 12" O.C. TO PROPERLYPOSITION THE NAILBASE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHING INTOEACH METAL STUDCONTINUOUS CLEAT SECURED@ 12" O.C.CONTINUOUS CLEAT SECURED @ 12" O.C.EXISTING WOOD BLOCKING,PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOM TO MATCHEXISTING SOFFIT DEPTHPRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDPRE-FINISHED J-TRIMSECURED TO ANGLE @ 12" O.C.COLD-FORMED ANGLE, SECURED TO WALL PANEL @ 12" O.C.PRE-FINISHED J-TRIM SECURED TOANGLE @ 12" O.C.PRE-FINISHED VENTED SOFFIT PANELS, SECURE TOJ-TRIM/ANGLEWOOD BLOCKING, SECURE TO ANGLES @12" O.C. STAGGERED.EAVE TRIM, SECURED @ 12" O.C. EXTEND TO MATCHBOTTOM OF FASCIA AT RAKECOLD-FORMED ANGLES, SECUREDTO PERIMETER DECK ANGLE @12" O.C; ADJUST TO MAINTAINSOFFIT AT ORIGINAL ELEVATION.(SOFFIT ELEVATION MAY BE RAISED IFEXISTING CONDITIONS WILL ALLOW)EXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE THROUGHTO OSB PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.No.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.2.1KEW/RTKEWAS SHOWNCONSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENTJ240008/09/2021HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESBID DOCUMENTS/PERMIT SETRAKE EDGE WITH WALL PANELS22.1SCALE: 3" = 1'-0"RAKE EDGE32.1SCALE: 3" = 1'-0"EAVE WITH GUTTER AT CMU12.1SCALE: 3" = 1'-0"RAKE EDGE WITH SOFFIT42.1SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ASPHALT SHINGLES, SECURE TO PLYWOOD WITH6 FASTENERS PER SHINGLEASPHALT RIDGE CAP SHINGLE MANUFACTUREDFOR USE WITH ROOF SLOPE AND RIDGE VENT -SET LAST SHINGLE IN A BED OF MASTIC PRIORTO FASTENING AND CAULK THE EXPOSEDFASTENER HEADSSYNTHETIC UNDERLAYMENT -OVERLAP AT RIDGE TOPROVIDE DOUBLE LAYER FOR18" ON EITHER SIDE OF RIDGE1"PRE-FINISHED DOWNSPOUT. SIZE, GENERAL PROFILE TO MATCHEXISTING. CONNECT TO GUTTER WITH OUTLET. SECURE WITH PRE-FINISHED STRAPS AT SAME LOCATIONS AS EXISTING. IF STRAP SPACINGEXCEEDS 8', INSTALL ADDITIONAL STRAPS AT CONSISTENT SPACING.DOWNSPOUT TO DISCHARGE IN SAME MANNER AS EXISTING(I.E. ONTO ADJACENT ROOF, ONTO GROUND)PRE-FINISHED GUTTER. SIZE AND GENERAL PROFILETO MATCH EXISTING. BACK LEG TO EXTEND A MIN. OF 1"HIGHER THAN OUTER LIP. SECURE THROUGH BACK LEG TOANGLE SUPPORT AND WALL PANEL WITH SCREWS @ 6" O.C.EVERY THIRD FASTENER WILL SECURE A GUTTER SPACER/STRAP (18"O.C.). FRONT EDGE OF GUTTER MUST BE AMIN. 1" BELOW THE ROOF EDGE.STARTER SHINGLE INSTALLED ALONG EAVE PRIOR TOFIRST COURSE OF SHINGLES. SECURE PER THEMANUFACTURER INSTALLATION REQUIREMENTS.ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL SMALL PIECE ALONGEAVE BEFORE DRIP EDGE. INSTALL ICE AND WATER SHIELD ALONG BOTTOM30" OF EAVE, OVERLAP TOP EDGE OF DRIP EDGE. INSTALL SYNTHETICUNDERLAYMENT OVER REST OF SURFACE, LAP OVER TOP EDGE OFICE AND WATER SHIELDEAVE ANGLE SUPPORT, SECURED TO DECK @ 12" O.C.EXISTING JOIST EXTENSIONSEXISTING CMU WALLEXISTING STEEL ANGLE/STOPAND PERIMETER WOOD BLOCKINGWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE VENTED NAILBASEMIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALLPANELS IF JOINTS DO NOT ALIGN WITH HAT CHANNELSPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALL PANELSIF NOT ALIGNED WITH HAT CHANNELSPRE-FINISHED J-TRIMSECURED TO ANGLE @12" O.C.COLD-FORMED ANGLE,SECURED TO WALL@ 12" O.C. STAGGEREDREMOVE EXISTING COLD-FORMED FRAMING TOALLOW FOR INSTALLATIONOF NEW COMPONENTS.LOCATED NEW FRAMINGSO THAT SOFFIT WILL BELOCATED AT THE SAMEELEVATION UNLESSOTHERWISE APPROVEDBY THE DESIGNER.COLD-FORMED CHANNELOR ANGLE, AT EACH HATCHANNEL, SECURED TOANGLES WITH 2 FASTENERSPER CONNECTIONWALL BASE TRIM AND CLOSURE, SECURED TO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12" O.C.PRE-FINISHED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEINSTALL GUTTER GUARDSUPPORTED BY SPACERS/STRAP AND FASTENED TOOUTER LIP (NOT SHOWN)EAVE TRIM, SECURED @ 12" O.C. EXTEND TO MATCHBOTTOM OF FASCIA AT RAKE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGH EIFSAND SHEATHINGINTO EACH METAL STUDEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELNAILBASE, SECURE TO OSB PER SPECIFICATIONS.TRIM TO FIT TIGHT WITH PERIMETER BLOCKINGEXISTING CEMENTITIOUS WOOD FIBER DECK,INSULATION, AND OSB COMPOSITE DECKASPHALT SHINGLESSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONG HIGH EAVE,WRAP UP AND OVER THE TOP OF THE BLOCKING. OVERLAP OVER TOPOF SYNTHETIC UNDERLAYMENT PRESENT OVER REST OF SURFACEEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDES1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHINGINTO EACH METAL STUDCOLD-FORMED ANGLE, SECURED TO WALL @ 12" O.C. STAGGEREDCOLD-FORMED CHANNEL OR ANGLE, AT EACH HATCHANNEL, SECURED TO ANGLES WITH 2 FASTENERSPER CONNECTIONPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALL PANELSIF NOT ALIGNED WITH HAT CHANNELSWALL BASE TRIM AND CLOSURE, SECURED TO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12" O.C., BOTH SIDESPRE-FINISHED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEFASCIA EXTENSION, SECURED @ 12" O.C. EXTENDTO MATCH BOTTOM OF FASCIA AT RAKECONTINUOUS CLEAT, SET IN MASTIC ANDSECURED THROUGH SHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED HIGH EAVE FLASHINGSECURE TO CLEAT AT OUTSIDE FACE AND FASTENTO CONTINUOUS CLEAT AT SHINGLES @8" O.C.WOOD BLOCKING, HEIGHT AS NEEDED TOPROPERLY SUPPORT CLEAT FOR HIGH EAVEFLASHING. SECURE @12" O.C. MAX TO HIGH EAVESUPPORT PLATEHIGH EAVE SUPPORT PLATE, SECURE TO DECK ANDPERIMETER HAT CHANNELS TO EXTEND SUPPORTSURFACE FOR BLOCKINGPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.PRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.COLD-FORMED ANGLE, SECURED TO WALL@ 12" O.C. STAGGEREDCONTINUOUS CLEAT SECURED @ 8" O.C.CONTINUOUS CLEAT SECURED @ 8" O.C.ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSB PER SPECIFICATIONS. FITINSULATION TIGHT TO WALLPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.WOOD BLOCKING SECURED THROUGHSHEATHING AT EACH METAL STUD TOPROVIDE NAILABLE SURFACE FORFLASHINGS AS NEEDEDEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESEXISTING EIFS OVER SHEATHING. CUTAND REMOVE EIFS SYSTEM TO EXPOSEEXTERIOR SHEATHING 12" FROM THEBOTTOM TO ALLOW FOR SHEATHINGINSPECTION AND PROPER INSTALLATIONOF THE NEW ROOF SYSTEM.1" DEEP HAT CHANNELS SPACED@ 24" O.C. MAX. SECURE THROUGHEIFS/INSULATION AND SHEATHING INTOEACH METAL STUDFOIL-FACED INSULATION INSTALLED TOREPLACE REMOVED EIFS DOWN TO THENEW NAILBASE INSULATION. SEAL ALLJOINTS WITH EIFS. TAPE ALL INSULATIONJOINTS AND OVER BLOCKINGSTRIP-IN TOP OF COUNTERFLASHINGWITH SELF-ADHERED FLASHINGWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELSELF-ADHERED ICE AND WATER SHIELD FOR 30" WIDTHALONG WALL. TURN UP WALL A MIN. OF 6" AND SEALAT TRANSITION.PRE-FINISHED COUNTERFLASHING,SECURED TO EACH STUD THROUGH THESHEATHING.PRE-FINISHED STEPPED BASE FLASHING LAYERED INTOTHE SHINGLES AND SECURED TO THE DECK ABOVE THEASSOCIATED SHINGLE COURSE. TURN BETWEENSHINGLES A MIN. 4" AND UP WALL A MIN.4" BEHIND COUNTERFLASHINGNAILBASE, SECURE TO OSB PER SPECIFICATIONS.EXISTING CEMENTITIOUS WOOD FIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE THROUGHTO OSB PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.EXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.2.2KEW/RTKEWAS SHOWNBID DOCUMENTS/PERMIT SETJ240008/09/2021EAVE WITH GUTTER AT METAL PANELS52.2SCALE: 3" = 1'-0"CONSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESHIGH EAVE62.2SCALE: 3" = 1'-0"RAKE WALL82.2SCALE: 3" = 1'-0"RIDGE72.2SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSB PERSPECIFICATIONS. TRIM BACK INSULATION TOALLOW FOR PERIMETER BLOCKING.EXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.SELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVEREDGE. INSTALL SYNTHETIC UNDERLAYMENT OVER REST OFSURFACE, LAP OVER TOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB ANDPERIMETER BLOCKING @ 12" O.C. TO PROPERLYPOSITION THE NAILBASE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHING INTOEACH METAL STUDCONTINUOUS CLEAT SECURED@ 12" O.C.CONTINUOUS CLEAT SECURED @ 12" O.C.EXISTING WOOD BLOCKING,PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOM TO MATCHEXISTING SOFFIT DEPTHPRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDPRE-FINISHED J-TRIMSECURED TO ANGLE @ 12" O.C.COLD-FORMED ANGLE, SECURED TO WALL PANEL @ 12" O.C.PRE-FINISHED J-TRIM SECURED TOANGLE @ 12" O.C.PRE-FINISHED VENTED SOFFIT PANELS, SECURE TOJ-TRIM/ANGLEWOOD BLOCKING, SECURE TO ANGLES @12" O.C. STAGGERED.COLD-FORMED ANGLES, SECUREDTO PERIMETER DECK ANGLE @12" O.C; ADJUST TO MAINTAINSOFFIT AT ORIGINAL ELEVATION.(SOFFIT ELEVATION MAY BE RAISED IFEXISTING CONDITIONS WILL ALLOW)EXISTING CMU WALL1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGH EIFSAND SHEATHINGINTO EACH METAL STUDWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSB PER SPECIFICATIONS. FITINSULATION TIGHT TO WALLPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.WOOD BLOCKING SECURED THROUGHSHEATHING AT EACH METAL STUD TOPROVIDE NAILABLE SURFACE FORVENTED FLASHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESEXISTING EIFS OVER SHEATHING. CUT AND REMOVE EIFSSYSTEM TO EXPOSE EXTERIOR SHEATHING BELOW ALLWINDOWS. AT OTHER LOCATIONS, REMOVE THE BOTTOM12" TO ALLOW FOR SHEATHING INSPECTION AND PROPERINSTALLATION OF THE NEW ROOF SYSTEM.1" DEEP HAT CHANNELS SPACED@ 24" O.C. MAX. SECURE THROUGHEIFS/INSULATION AND SHEATHING INTOEACH METAL STUDFOIL-FACED INSULATION INSTALLED TOREPLACE REMOVED EIFS DOWN TO THENEW NAILBASE INSULATION. SEAL ALLJOINTS WITH EIFS. TAPE ALL INSULATIONJOINTS AND OVER BLOCKINGSTRIP-IN TOP OF COUNTERFLASHINGWITH SELF-ADHERED FLASHINGWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONGHIGH EAVE, WRAP EDGE OF PLYWOOD DECK BUT DO NOTBLOCK VENTING. OVERLAP OVER TOP OF SYNTHETICUNDERLAYMENT PRESENT OVER REST OFSURFACEEXPANDED METAL SUPPORT SCREEN SECUREDTO BRACKET AND WALLCONTINUOUS 20 GA. CLEATSET IN MASTIC AND SECURED THROUGHSHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED METAL FLASHING.SECURE WITH EXPOSED FASTENER WITHWASHER THROUGH COUNTERFLASHING INTOBLOCKING AND AT CLEATPRE-FINISHED COUNTERFLASHING,SECURED TO EACH STUD THROUGH THESHEATHING.PRE-FINISHED METAL FLASHING SECURED TOTHE EXISTING SILL FLASHING WITH POP RIVETSTHROUGH SEALANT AT 12" O.C.CONTINUOUS HAT CHANNEL SUPPORT SECUREDTHROUGH EIFS AND SHEATHING INTO EACHMETAL STUDPRE-FINISHED METAL WALL PANELS. FLUSH PROFILEWITH CONCEALED FASTENERS AND VERTICALORIENTATIONEXISTING WINDOWASSEMBLYEXISTING STUD WALLWITH SHEATHINGAND EIFSHAT CHANNELS @ 24" OC.,SECURED THROUGH EIFSAND SHEATHING INTO EACHMETAL STUDPRE-FINISHED WALL PANEL SECUREDTO HAT CHANNELPRE-FINISHED CORNER TRIMFASTEN TO HAT CHANNEL @ 12" OCAND RIVET TO WALL PANELEXISTING WINDOWASSEMBLYEXISTING STUD WALL WITHSHEATHING AND EIFSREPLACE SEALANTJOINTPRE-FINISHED CLOSURE TRIMFASTEN TO HAT CHANNEL @ 12" OCHAT CHANNEL @ 24" OC., SECUREDTHROUGH EIFS AND SHEATHING AT EACHMETAL STUDPRE-FINISHED WALL PANEL SECUREDTO HAT CHANNELPRE-FINISHED BASE TRIMFASTEN TO HAT CHANNEL @ 12" OCEXISTING WINDOWASSEMBLYREPLACE SEALANT JOINTAROUND PERIMETERPRE-FINISHED CLOSURE TRIMFASTEN TO HAT CHANNEL @ 12" OCASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKNAILBASE, SECURE TO OSBPER SPECIFICATIONS. FITINSULATION TIGHT TO WALLEXISTING MASONRY WALLSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONGHIGH EAVE, FASTENED TO WALL AND UNDER EXISTINGFLASHING. OVERLAP OVER TOP OF SYNTHETICUNDERLAYMENT PRESENT OVER REST OF SURFACECONTINUOUS 20 GA. CLEATSET IN MASTIC AND SECURED THROUGHSHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED METAL FLASHING.SECURE WITH EXPOSED FASTENER WITHWASHER THROUGH COUNTERFLASHING INTO MASONRYEXISTING FLASHING TRIMMEDTO FORM RECEIVEREXISTING WINDOW - REMOVE ANDREPLACE PERIMETER JOINT SEALANT12-14 X 1-1/4 SD FASTENEREXISTING WINDOW SILL FLASHING(PROTECT FOR REUSE)REPLACE SEALANT JOINT (DO NOTBLOCK WEEPS IF PRESENT)1"3"REMOVE EIFS DIRECTLY BELOWWINDOW (12") TO INSPECT/REPAIRSHEATHING. INSTALL NEW FOILFACED INSULATION TO REPLACEREMOVED AREA AND SEAL JOINTSWITH EIFS.SILLHEADJAMBNOTE: SEE DETAIL 12/2.3 FOR WALL PANELDETAILS AT WINDOWSNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.2.3KEW/RTKEWAS SHOWNBID DOCUMENTS/PERMIT SETJ240008/09/2021CONSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESRAKE WALL92.3SCALE: 3" = 1'-0"HEAD WALL TO WALL PANELS102.3SCALE: 3" = 1'-0"HEAD WALL TO MASONRY112.3SCALE: 3" = 1'-0"HEAD JAMB, JAMBS, AND SILL TO METAL PANEL122.3SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E PRE-FINISHED DOWNSPOUT. SIZE, GENERAL PROFILE TO MATCHEXISTING. CONNECT TO GUTTER WITH OUTLET. SECURE WITH PRE-FINISHED STRAPS AT SAME LOCATIONS AS EXISTING. IF STRAP SPACINGEXCEEDS 8', INSTALL ADDITIONAL STRAPS AT CONSISTENT SPACING.DOWNSPOUT TO DISCHARGE IN SAME MANNER AS EXISTING(I.E. ONTO ADJACENT ROOF, ONTO GROUND)PRE-FINISHED GUTTER. SIZE AND GENERAL PROFILETO MATCH EXISTING. BACK LEG TO EXTEND A MIN. OF 1"HIGHER THAN OUTER LIP. SECURE THROUGH BACK LEG TOANGLE SUPPORT AND WALL PANEL WITH SCREWS @ 6" O.C.EVERY THIRD FASTENER WILL SECURE A GUTTER SPACER/STRAP (18"O.C.). FRONT EDGE OF GUTTER MUST BE AMIN. 1" BELOW THE ROOF EDGE.1"STARTER SHINGLE INSTALLED ALONG EAVE PRIOR TOFIRST COURSE OF SHINGLES. SECURE PER THEMANUFACTURER INSTALLATION REQUIREMENTS.ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL SMALL PIECE ALONGEAVE BEFORE DRIP EDGE. INSTALL ICE AND WATER SHIELD ALONG BOTTOM30" OF EAVE, OVERLAP TOP EDGE OF DRIP EDGE. INSTALL SYNTHETICUNDERLAYMENT OVER REST OF SURFACE, LAP OVER TOP EDGE OFICE AND WATER SHIELDVENTED NAILBASE, SECURE THROUGH WOODSPACERS PER SPECIFICATIONS. TRIM BACK INSULATION TOALLOW FOR PERIMETER BLOCKING AND VENTILATION.EXISTING CEMENTITIOUS WOOD FIBER DECK, INSULATION,AND OSB COMPOSITE DECKEAVE ANGLE SUPPORT, SECURED TO DECK @ 12" O.C.EXISTING JOIST EXTENSIONSEXISTING CMU WALLEXISTING STEEL ANGLE/STOPAND PERIMETER WOOD BLOCKINGWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE VENTED NAILBASEMIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALLPANELS IF JOINTS DO NOT ALIGN WITH HAT CHANNELSPRE-FINISHED METAL WALL PANELS WITH CONCEALED FASTENERSAND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALL PANELSIF NOT ALIGNED WITH HAT CHANNELSPRE-FINISHED J-TRIMSECURED TO ANGLE @12" O.C.COLD-FORMED ANGLE,SECURED TO WALL@ 12" O.C. STAGGEREDREMOVE EXISTING COLD-FORMED FRAMING TOALLOW FOR INSTALLATIONOF NEW COMPONENTS.LOCATED NEW FRAMINGSO THAT SOFFIT WILL BELOCATED AT THE SAMEELEVATION UNLESSOTHERWISE APPROVEDBY THE DESIGNER.COLD-FORMED CHANNELOR ANGLE, AT EACH HATCHANNEL, SECURED TOANGLES WITH 2 FASTENERSPER CONNECTIONWALL BASE TRIM AND CLOSURE, SECURED TO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12" O.C.PRE-FINISHED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEINSTALL GUTTER GUARDSUPPORTED BY SPACERS/STRAP AND FASTENED TOOUTER LIP (NOT SHOWN)ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONG PERIMETEREXTEND 30" ONTO ROOF AND TURN DOWN OVER EDGE. INSTALLSYNTHETIC UNDERLAYMENT OVER REST OF SURFACE, LAP OVER TOPEDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE NAILBASEEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKEXISTING CMU WALLPRE-FINISHED METAL WALL PANELS WITH CONCEALEDFASTENERS AND FLUSH JOINTS. SECURE TO HATCHANNELS. EXTEND PAST BOTTOM OF EIFS AND COVERCMU. BOTTOM ELEVATION TO MATCH SOFFIT AT EAVE1" DEEP HAT CHANNELS SPACED @ 24" O.C. MAX.SECURE THROUGH EIFS AND SHEATHING INTOEACH METAL STUDWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELEXISTING EIFS OVERSHEATHINGEXISTING METAL STUD WALLWITH GYPSUM BOARD SHEATHINGON BOTH SIDESVENTED NAILBASE, SECURE THROUGHWOOD SPACERS PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.CONTINUOUS CLEAT SECURED @ 12" O.C.PRE-FINISHED FASCIA EXTENSION, SECURED @ 12" O.C.OVERLAP WALL PANEL BY 1.5" MIN.CONTINUOUS CLEAT SECURED @ 12" O.C.WOOD BLOCKING, SECURE TO EXISTING BLOCKING@12" O.C. STAGGERED TO BRING BLOCKING FLUSHWITH THE NEW WALL PANELSEXISTING WOOD BLOCKINGASPHALT SHINGLESSELF-ADHERED ICE AND WATER SHIELD, INSTALLALONG PERIMETER EXTEND 30" ONTO ROOF ANDTURN DOWN OVER EDGE. INSTALL SYNTHETICUNDERLAYMENT OVER REST OF SURFACE, LAP OVERTOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSBAND PERIMETER BLOCKING @ 12" O.C. TOPROPERLY POSITION THE NAILBASEEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURE THROUGHWOOD SPACERS PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURE TO OSBPER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.EXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.SELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVEREDGE. INSTALL SYNTHETIC UNDERLAYMENT OVER REST OFSURFACE, LAP OVER TOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB ANDPERIMETER BLOCKING @ 12" O.C. TO PROPERLYPOSITION THE NAILBASE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHING INTOEACH METAL STUDCONTINUOUS CLEAT SECURED@ 12" O.C.CONTINUOUS CLEAT SECURED @ 12" O.C.EXISTING WOOD BLOCKING,PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOM TO MATCHEXISTING SOFFIT DEPTHPRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDPRE-FINISHED J-TRIMSECURED TO ANGLE @ 12" O.C.COLD-FORMED ANGLE, SECURED TO WALL PANEL @ 12" O.C.PRE-FINISHED J-TRIM SECURED TOANGLE @ 12" O.C.PRE-FINISHED VENTED SOFFIT PANELS, SECURE TOJ-TRIM/ANGLEWOOD BLOCKING, SECURE TO ANGLES @12" O.C. STAGGERED.PRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDCONTINUOUS CLEAT SECURED@ 12" O.C.PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOMELEVATION TO REMAIN CONSISTENTWITH DETAIL AT WALL PANELSCONTINUOUS CLEAT SECURED@ 12" O.C.WOOD BLOCKING TO MATCHFASCIA AT WALL PANELS, SECURETO EXISTING BLOCKING @12"O.C. STAGGEREDWOOD BLOCKING TO MATCH BOTTOMOF FASCIA, SECURED @ 12" O.C.PRE-FINISHED CLOSURE METALEXISTING CMU WALLEXISTINGWOODBLOCKINGCOLD-FORMED ANGLES, SECUREDTO PERIMETER DECK ANGLE @12" O.C; ADJUST TO MAINTAINSOFFIT AT ORIGINAL ELEVATION.(SOFFIT ELEVATION MAY BE RAISED IFEXISTING CONDITIONS WILL ALLOW)No.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.3.1KEW/RTKEWAS SHOWNCONSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENTJ240008/09/2021HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESBID DOCUMENTS/PERMIT SETRAKE EDGE WITH WALL PANELS (VENTED DECK)2A3.1SCALE: 3" = 1'-0"RAKE EDGE (VENTED DECK)3A3.1SCALE: 3" = 1'-0"EAVE WITH GUTTER @ CMU (VENTED DECK)1A3.1SCALE: 3" = 1'-0"RAKE EDGE WITH SOFFIT (VENTED DECK)4A3.1SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 1"PRE-FINISHED DOWNSPOUT. SIZE, GENERAL PROFILE TO MATCHEXISTING. CONNECT TO GUTTER WITH OUTLET. SECURE WITH PRE-FINISHED STRAPS AT SAME LOCATIONS AS EXISTING. IF STRAP SPACINGEXCEEDS 8', INSTALL ADDITIONAL STRAPS AT CONSISTENT SPACING.DOWNSPOUT TO DISCHARGE IN SAME MANNER AS EXISTING(I.E. ONTO ADJACENT ROOF, ONTO GROUND)PRE-FINISHED GUTTER. SIZE AND GENERAL PROFILETO MATCH EXISTING. BACK LEG TO EXTEND A MIN. OF 1"HIGHER THAN OUTER LIP. SECURE THROUGH BACK LEG TOANGLE SUPPORT AND WALL PANEL WITH SCREWS @ 6" O.C.EVERY THIRD FASTENER WILL SECURE A GUTTER SPACER/STRAP (18"O.C.). FRONT EDGE OF GUTTER MUST BE AMIN. 1" BELOW THE ROOF EDGE.STARTER SHINGLE INSTALLED ALONG EAVE PRIOR TOFIRST COURSE OF SHINGLES. SECURE PER THEMANUFACTURER INSTALLATION REQUIREMENTS.ASPHALT SHINGLESPRE-FINISHED METAL DRIP EDGE, SECURED ATFLANGE WITH NAILS @ 3" O.C. STAGGEREDSELF-ADHERED ICE AND WATER SHIELD, INSTALL SMALL PIECE ALONGEAVE BEFORE DRIP EDGE. INSTALL ICE AND WATER SHIELD ALONG BOTTOM30" OF EAVE, OVERLAP TOP EDGE OF DRIP EDGE. INSTALL SYNTHETICUNDERLAYMENT OVER REST OF SURFACE, LAP OVER TOP EDGE OFICE AND WATER SHIELDVENTED NAILBASE, SECURE THROUGH WOODSPACERS PER SPECIFICATIONS. TRIM BACK INSULATION TOALLOW FOR PERIMETER BLOCKING AND VENTILATION.EXISTING CEMENTITIOUS WOOD FIBER DECK, INSULATION,AND OSB COMPOSITE DECKEAVE ANGLE SUPPORT, SECURED TO DECK @ 12" O.C.EXISTING JOIST EXTENSIONSEXISTING CMU WALLEXISTING STEEL ANGLE/STOPAND PERIMETER WOOD BLOCKINGWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE VENTED NAILBASEMIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALLPANELS IF JOINTS DO NOT ALIGN WITH HAT CHANNELSPRE-FINISHED METAL WALL PANELS WITH CONCEALED FASTENERSAND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TO EACHHAT CHANNEL TO PROVIDE SECUREMENT POINT FOR WALL PANELSIF NOT ALIGNED WITH HAT CHANNELSPRE-FINISHED J-TRIMSECURED TO ANGLE @12" O.C.COLD-FORMED ANGLE,SECURED TO WALL@ 12" O.C. STAGGEREDREMOVE EXISTING COLD-FORMED FRAMING TOALLOW FOR INSTALLATIONOF NEW COMPONENTS.LOCATED NEW FRAMINGSO THAT SOFFIT WILL BELOCATED AT THE SAMEELEVATION UNLESSOTHERWISE APPROVEDBY THE DESIGNER.COLD-FORMED CHANNELOR ANGLE, AT EACH HATCHANNEL, SECURED TOANGLES WITH 2 FASTENERSPER CONNECTIONWALL BASE TRIM AND CLOSURE, SECURED TO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12" O.C.PRE-FINISHED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEINSTALL GUTTER GUARDSUPPORTED BY SPACERS/STRAP AND FASTENED TOOUTER LIP (NOT SHOWN)EAVE TRIM, SECURED @ 12" O.C. EXTEND TO MATCHBOTTOM OF FASCIA AT RAKE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGH EIFSAND SHEATHINGINTO EACH METAL STUDEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.VENTED NAILBASE, SECURE THROUGH SPACERS TO OSBPER SPECIFICATIONS. TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING AND VENTILATION.EXISTING CEMENTITIOUS WOOD FIBER DECK,INSULATION, AND OSB COMPOSITE DECKASPHALT SHINGLESSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONG HIGH EAVE,WRAP EDGE OF PLYWOOD DECK BUT DO NOT BLOCK VENTING.OVERLAP OVER TOP OF SYNTHETIC UNDERLAYMENT PRESENT OVERREST OF SURFACEWOOD BLOCKING. SECURE TO EXISTING OSB AND PERIMETERBLOCKING @ 12" O.C. TO PROPERLY POSITION THE VENTED NAILBASEEXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDES1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHINGINTO EACH METAL STUDCOLD-FORMED ANGLE, SECURED TO WALL @ 12" O.C. STAGGEREDCOLD-FORMED CHANNEL OR ANGLE, AT EACH HATCHANNEL, SECURED TO ANGLES WITH 2 FASTENERSPER CONNECTIONCONTINUOUS RAISED CLEAT SECURED TO TOPAND FACE OF BLOCKING @8" O.C.PRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS1-1/2" DEEP HAT CHANNELS SPACED @ 12" O.C.MIN. 2" WIDE FLAT PLATE, CONTINUOUS, SECURED TOEACH HAT CHANNEL TO PROVIDE SECUREMENT POINTFOR WALL PANELS IF NOT ALIGNED WITH HATCHANNELSWALL BASE TRIM AND CLOSURE, SECUREDTO THE HAT CHANNELPRE-FINISHED J-TRIM SECURED TO ANGLE @ 12"O.C., BOTH SIDESPRE-FINISHED SOFFIT PANELS, SECURE TO J-TRIM/ANGLEFASCIA EXTENSION, SECURED @ 12" O.C. EXTENDTO MATCH BOTTOM OF FASCIA AT RAKEEXPANDED METAL SUPPORT SCREEN SECUREDTO SPACER AND BRACKETSPACERS @ 16" O.C. SECUREDTO RAISED CLEAT AND ZEE BRACKETCONTINUOUS 20 GA. ZEE-SHAPED BRACKETSET IN MASTIC AND SECURED THROUGHSHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED HIGH EAVE METAL COVERSECURE TO CLEAT AND SUPPORT SCREENWOOD BLOCKING, HEIGHT AS NEEDED TOPROPERLY SUPPORT RAISED CLEAT ANDVENTED ASSEMBLY. SECURE @12" O.C. MAX TOHIGH EAVE SUPPORT PLATEHIGH EAVE SUPPORT PLATE, SECURE TO DECK ANDPERIMETER HAT CHANNELS TO EXTEND SUPPORTSURFACE FOR BLOCKINGPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.COLD-FORMED ANGLE, SECURED TO WALL@ 12" O.C. STAGGEREDCONTINUOUS CLEAT SECURED @ 8" O.C.ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURE THROUGH SPACERS TO OSB PERSPECIFICATIONS. FIT INSULATION TIGHT TO WALLPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.WOOD BLOCKING SECURED THROUGHSHEATHING AT EACH METAL STUD TOPROVIDE NAILABLE SURFACE FORFLASHINGS AS NEEDEDEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESEXISTING EIFS OVER SHEATHING. CUTAND REMOVE EIFS SYSTEM TO EXPOSEEXTERIOR SHEATHING 12" FROM THEBOTTOM TO ALLOW FOR SHEATHINGINSPECTION AND PROPER INSTALLATIONOF THE NEW ROOF SYSTEM.1" DEEP HAT CHANNELS SPACED@ 24" O.C. MAX. SECURE THROUGHEIFS/INSULATION AND SHEATHING INTOEACH METAL STUDFOIL-FACED INSULATION INSTALLED TOREPLACE REMOVED EIFS DOWN TO THENEW NAILBASE INSULATION. SEAL ALLJOINTS WITH EIFS. TAPE ALL INSULATIONJOINTS AND OVER BLOCKINGSTRIP-IN TOP OF COUNTERFLASHINGWITH SELF-ADHERED FLASHINGWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELSELF-ADHERED ICE AND WATER SHIELD FOR 30" WIDTHALONG WALL. TURN UP WALL A MIN. OF 6" AND SEALAT TRANSITION.PRE-FINISHED COUNTERFLASHING,SECURED TO EACH STUD THROUGH THESHEATHING.PRE-FINISHED STEPPED BASE FLASHING LAYERED INTOTHE SHINGLES AND SECURED TO THE DECK ABOVE THEASSOCIATED SHINGLE COURSE. TURN BETWEENSHINGLES A MIN. 4" AND UP WALL A MIN.4" BEHIND COUNTERFLASHING2"2"STOP VENTED RIDGE DETAIL 18" BACK FROM END OF RIDGE.PLYWOOD SHOULD BE KEPT CONTINUOUS AND COVERED WITHUNDERLAYMENT WHERE VENT TOPS.ASPHALT SHINGLES, SECURE TO PLYWOOD WITH6 FASTENERS PER SHINGLEASPHALT RIDGE CAP SHINGLE MANUFACTUREDFOR USE WITH ROOF SLOPE AND RIDGE VENT - SET LASTSHINGLE IN A BED OF MASTIC PRIOR TO FASTENING ANDCAULK THE EXPOSED FASTENER HEADSSYNTHETIC UNDERLAYMENTVENTED NAILBASE, SECURE THROUGH WOOD SPACERS PERSPECIFICATIONS.EXISTING CEMENTITIOUS WOOD FIBER DECK, INSULATION,AND OSB COMPOSITE DECKBAFFLED RIDGE VENTNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.3.2KEW/RTKEWAS SHOWNBID DOCUMENTS/PERMIT SETJ240008/09/2021CONSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESHIGH EAVE (VENTED DECK)6A3.2SCALE: 3" = 1'-0"RAKE WALL (VENTED DECK)8A3.2SCALE: 3" = 1'-0"VENTED RIDGE (VENTED DECK)7A3.2SCALE: 3" = 1'-0"GUTTER AT METAL WALL PANELS (VENTED DECK)5A3.2SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURE THROUGHSPACERS TO OSB PER SPECIFICATIONS.TRIM BACK INSULATION TO ALLOWFOR PERIMETER BLOCKING.EXISTING EIFS OVERSHEATHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.SELF-ADHERED ICE AND WATER SHIELD, INSTALL ALONGPERIMETER EXTEND 30" ONTO ROOF AND TURN DOWN OVEREDGE. INSTALL SYNTHETIC UNDERLAYMENT OVER REST OFSURFACE, LAP OVER TOP EDGE OF ICE AND WATER SHIELDWOOD BLOCKING. SECURE TO EXISTING OSB ANDPERIMETER BLOCKING @ 12" O.C. TO PROPERLYPOSITION THE NAILBASE1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGHEIFS AND SHEATHING INTOEACH METAL STUDCONTINUOUS CLEAT SECURED@ 12" O.C.CONTINUOUS CLEAT SECURED @ 12" O.C.EXISTING WOOD BLOCKING,PRE-FINISHED FASCIA EXTENSION,SECURED @ 12" O.C. BOTTOM TO MATCHEXISTING SOFFIT DEPTHPRE-FINISHED METAL DRIP EDGE,SECURED AT FLANGE WITH NAILS@ 3" O.C. STAGGEREDPRE-FINISHED J-TRIMSECURED TO ANGLE @ 12" O.C.COLD-FORMED ANGLE, SECURED TO WALL PANEL @ 12" O.C.PRE-FINISHED J-TRIM SECURED TOANGLE @ 12" O.C.PRE-FINISHED VENTED SOFFIT PANELS, SECURE TOJ-TRIM/ANGLEWOOD BLOCKING, SECURE TO ANGLES @12" O.C. STAGGERED.COLD-FORMED ANGLES, SECUREDTO PERIMETER DECK ANGLE @12" O.C; ADJUST TO MAINTAINSOFFIT AT ORIGINAL ELEVATION.(SOFFIT ELEVATION MAY BE RAISED IFEXISTING CONDITIONS WILL ALLOW)EXISTING CMU WALL1" DEEP HAT CHANNELSSPACED @ 24" O.C.MAX. SECURE THROUGH EIFSAND SHEATHINGINTO EACH METAL STUDWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURE THROUGH SPACERSTO OSB PER SPECIFICATIONS. FIT INSULATION TIGHTTO WALL, TRIM BACK PLYWOOD TO ALLOW FOR MIN. 1" WIDEVENTILATION SPACEPRE-FINISHED METAL WALL PANELS WITHCONCEALED FASTENERS AND FLUSH JOINTS.SECURE TO HAT CHANNELS.WOOD BLOCKING SECURED THROUGHSHEATHING AT EACH METAL STUD TOPROVIDE NAILABLE SURFACE FORVENTED FLASHINGEXISTING METAL STUDWALL WITH GYPSUMBOARD SHEATHINGON BOTH SIDESEXISTING EIFS OVER SHEATHING. CUTAND REMOVE EIFS SYSTEM TO EXPOSEEXTERIOR SHEATHING BELOW ALLWINDOWS. AT OTHER LOCATIONS,REMOVE THE BOTTOM 12" TO ALLOWFOR SHEATHING INSPECTION ANDPROPER INSTALLATION OF THE NEWROOF SYSTEM.1" DEEP HAT CHANNELS SPACED@ 24" O.C. MAX. SECURE THROUGHEIFS/INSULATION AND SHEATHING INTOEACH METAL STUDFOIL-FACED INSULATION INSTALLED TOREPLACE REMOVED EIFS DOWN TO THENEW NAILBASE INSULATION. SEAL ALLJOINTS WITH EIFS. TAPE ALL INSULATIONJOINTS AND OVER BLOCKINGSTRIP-IN TOP OF COUNTERFLASHINGWITH SELF-ADHERED FLASHINGWALL BASE TRIM AND CLOSURE,SECURED TO THE HAT CHANNELSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONGHIGH EAVE, WRAP EDGE OF PLYWOOD DECK BUT DO NOTBLOCK VENTING. OVERLAP OVER TOP OF SYNTHETICUNDERLAYMENT PRESENT OVER REST OFSURFACEEXPANDED METAL SUPPORT SCREEN SECUREDTO BRACKET AND WALLCONTINUOUS 20 GA. ZEE-SHAPED BRACKETSET IN MASTIC AND SECURED THROUGHSHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED METAL VENTED COVER.SECURE WITH EXPOSED FASTENER WITHWASHER THROUGH COUNTERFLASHING INTOBLOCKING AND HOOK ONTO SUPPORT SCREENPRE-FINISHED COUNTERFLASHING,SECURED TO EACH STUD THROUGH THESHEATHING.ASPHALT SHINGLES. CUT TO FITOVER/AROUND PIPE TIGHTLY ANDSET INTO ASPHALT ROOF CEMENTLEAD FLASHING WITH 8" MIN FLANGE. SET INASPHALT ROOF CEMENT AND FOLD INTO TOP OFPIPE (A CAP CAN BE FORMED TO COVER THE TOPOF THE PIPE). THE DOWNSLOPE SIDE OF THEFLASHING FLANGE SHOULD BE HEMMED ANDEXTEND OVER THE TOP OF THE SHINGLES.UPSLOPE AND SIDES OF FLASHINGFLANGE SHOULD BE FASTENED TO THEDECK, STRIPPED IN BY UNDERLAYMENTAND COVERED WITH SHINGLES. SETEDGE OF SHINGLE INTO ROOF CEMENT.ASPHALT SHINGLESEXISTING CEMENTITIOUS WOODFIBER DECK, INSULATION,AND OSB COMPOSITE DECKVENTED NAILBASE, SECURETHROUGH SPACERS TO OSBPER SPECIFICATIONS.EXISTINGMASONRYWALLSELF-ADHERED ICE AND WATER SHIELD FOR 30" ALONGHIGH EAVE, WRAP EDGE OF PLYWOOD DECK BUT DO NOTBLOCK VENTING. OVERLAP OVER TOP OF SYNTHETICUNDERLAYMENT PRESENT OVER REST OFSURFACEEXISTING FLASHING TRIMMEDTO FORM RECEIVERMIN. 4'' DOWNSLOPEMIN. 4'' UPSLOPENAIL2 ON UPSLOPENEW SEALANT DEPTH "d"SEALANTPRIME SURFACESBACKER RODFOR JOINT WIDTHMAKE SEALANT DEPTHW < 1/2"W > 1/2"D = 1/4"D = (1/2)WJOINTWIDTH "W"OUTSIDEINSIDESEALANT JOINTEXISTING WINDOWABCC1.USE BOND BREAKER TAPE.2.A AND B ARE TO BE A MINIMUM OF 1/4"3.C IS A MINIMUM OF 1/4"4.TOOL JOINT SLIGHTLY CONCAVE1"3"CONTINUOUS 20 GA. CLEATSET IN MASTIC AND SECURED THROUGHSHINGLES INTO THE DECK @ 6" O.C.PRE-FINISHED METAL FLASHING. SECUREWITH EXPOSED FASTENER WITH WASHERTHROUGH COUNTERFLASHING INTO MASONRYJOINTFILLETNOTE: FOR FLUE VENTS/HOT PIPES, INCLUDE ARAIN CAP OVER THE TOP OF THE NEW SLEEVEOR EXTEND EXISTING CAP TO MAINTAINWATERTIGHTNESS.No.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.3.3KEW/RTKEWAS SHOWNBID DOCUMENTS/PERMIT SETJ240008/09/2021COSTRUCTION DETAILS MOTOR POOL MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICESRAKE WALL (VENTED DECK)9A3.3SCALE: 3" = 1'-0"HEAD WALL TO WALL PANELS (VENTED DECK)10A3.3SCALE: 3" = 1'-0"HEAD WALL TO MASONRY (VENTED DECK)11A3.3SCALE: 3" = 1'-0"ROUND PENENTRATION12A3.3SCALE: 3" = 1'-0"SEALANT JOINT/FILLET JOINT13A2.3SCALE: 3" = 1'-0"DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E PROJECT MANUAL FOR MOTOR POOL MAIN BUILDING ROOF REPLACEMENT ORANGE COUNTY, HILLSBOROUGH, NC Prepared for ORANGE COUNTY ASSET MANAGEMENT 300 W. TRYON STREET, B BLDG., 3RD FLOOR HILLSBOROUGH, NC 27278 Prepared by ATLAS ENGINEERING, INC. 551-A PYLON DRIVE RALEIGH, NORTH CAROLINA 27606 ATLAS JOB NO. J2400 AUGUST 2021 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E TABLE OF CONTENTS TITLE PAGE Provided by Orange County TABLE OF CONTENTS Front End Documents and Form of Proposal to be provided by Orange County DIVISION 1- GENERAL REQUIREMENTS 010100 Summary of Work 012100 Base Bid Allowances (Estimated Quantities) 012500 Project Meetings 013300 Submittals 014000 Quality Control 015000 Construction Facilities 016000 Materials and Equipment 017700 Project Closeout DIVISION 2- SITEWORK 024110 Selective Demolition DIVISION 6- WOOD AND PLASTICS 061000 Rough Carpentry DIVISION 7- THERMAL AND MOISTURE PROTECTION 073113 Asphalt Shingled Roof System 076200 Flashing and Sheet Metal Trim 079200 Joint Sealants DIVISION 23- MECHANICAL 230800 General Mechanical and Electrical Requirements DRAWINGS COV Cover Sheet with Building Code Summary 1.0 Roof Plan and Elevations (Partial) 2.0 Roof Plan (Alt. 1) and Wind Uplift Zone 2.1 Construction Details 2.2 Construction Details 2.3 Construction Details 3.1 Construction Details 3.2 Construction Details 3.3 Construction Details DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.1 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 010100 SUMMARY OF WORK PART 1 GENERAL 1.01 GENERAL DESCRIPTION OF WORK INCLUDED A. Furnish labor, equipment, materials, services and supervision necessary to complete the work outlined in these technical specifications and drawings for roof replacement and associated work at the Motor Pool Main Building located at 600 Highway 86 North in Hillsborough, North Carolina. B. The following is a summary of roof replacement work items included. This summary is not intended to be an all-inclusive scope of work. Refer to individual specification sections and drawings for more specific project requirements. 1. Perform a Pre-Job Damage Survey prior to the start of work. The purpose of the survey is to document existing conditions and identify existing damages/distresses. Survey must include roof-top components, building exterior, site features (pavements, walkways, landscaping, etc.), building interior, applicable equipment, and other applicable components. A pre-job damage survey is considered to be a protection for the contractor and documentation will be used to assist the Owner, Designer and Contractor in determining whether damages noted during construction were caused by construction activities or were existing. 2. The existing roof system generally consists of asphalt shingles over underlayment, 7/16” oriented strand board, 2.5” polyisocyanurate insulation, and a 2” thick tongue and groove structural cementitious wood fiber deck. Roof slope is 4:12. 3. Remove existing asphalt shingles, underlayment, perimeter edge metal, gutters, fascia, soffit, downspouts, and support framing at the soffit/overhang to expose the existing oriented strand board. Care must be taken to avoid damage to the existing substrate during removal of the existing roofing. Sequence the work so that crews do not remove more of the existing roof system than can be maintained in a watertight condition prior to the end of each workday. Removed materials should be disposed of legally off-site unless otherwise agreed upon with the Owner. 4. Remove the EIFS (coating and insulation) to expose the bottom of the sheathing along transitions with the adjacent shingled roof system and directly below all window/louver assemblies on the south elevation to allow for inspection and potential repair of the sheathing. 5. Protect components that will remain for reuse, including, but not limited to, nailable substrate, portions of wood blocking, portions of EIFS, sheathing, masonry walls, windows, penetrations, louvers, etc. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.2 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 6. Inspect the existing oriented strand board, wood blocking, sheathing, and other components noted to remain. Make repairs to, or replace, damaged or deteriorated materials in accordance with applicable sections of these specifications. Protect and reuse existing wood blocking and cold-formed soffit support only where shown on the design details or when specifically approved on-site by the Designer. Otherwise install new materials. Inspect the securement of the existing oriented strand board and install supplemental fasteners in accordance within applicable sections of these specifications to provide wind uplift resistance in accordance with the North Carolina State Building Code and ASCE-7. Refer to base bid allowances (estimated quantities of work in Section 012100) for additional information. 7. Inspect roof penetrations and raise/extend penetrations as needed so they will maintain a minimum 8” vertical flashing height above the shingled roof at the new roof thickness. Extend/modify any mechanical connections, ductwork, etc. as necessary to raise penetrations to required heights. 8. Inspect existing securement of wood blocking that will remain in use. Install supplemental fastening of existing blocking as noted on the drawings to ensure adequate wind uplift pressure resistance. Install new wood blocking where shown on the drawings to form the roof perimeter and accommodate the new thickness of the roof system. 9. Base Bid: Install and mechanically fasten a layer of nail base insulation (rigid insulation with factory adhered plywood substrate) directly over existing OSB. Secure in accordance with the manufacturer’s requirements and Section 073113, Item 3.02 in this project manual. 10. Alternate Bid #1: Install and mechanically fasten a layer of vented nailbase directly over the existing OSB. Secure in accordance with the manufacturer’s requirements and Section 073113, Item 3.02 in this project manual. Trim/adjust the vented nailbase along eave and high eave perimeters to allow for installation of vented details. 11. Install self-adhered ice and water shield around all eaves, rake edges, high eaves, ridges, and penetrations including at transitions with adjacent walls. Install specified underlayment over the remainder of the roof area and provide proper laps with self- adhered membrane and perimeter metal. 12. Provide and install counterflashings, sheetmetal flashings, cleats, fascia, soffits, cold- formed support framing, wall panels, trim, gutters, downspouts, straps, and other sheetmetal trim and sealants as shown on the drawings for proper installation of the design details. Wall panels shall be installed on support framing to cover all EIFS areas. At areas of EIFS removed beneath window assemblies and at transitions with the adjacent shingled roof, install self-adhered underlayment over sheathing and foil faced polyisocyanurate insulation to match the thickness of the adjacent EIFS before installation of supports and wall panels. Install pre-fabricated gutter guards at all gutters. 13. Install new asphalt shingled roof system on all roof areas including vented eave and high eave/ridge details if Alternate Bid 01 is selected. Install metal flashings where the DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.3 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 shingles transition to adjacent walls. New roof system must meet the requirements for UL Class A fire classification and wind uplift resistance in accordance with these specifications, the North Carolina State Building Code and be eligible for the specified manufacturer warranty. Shingle nails are to be hand driven unless otherwise approved by the Designer. 14. Remove existing sealant around the perimeters of the window/louver frames on the south elevation. Clean and prime the surfaces to be sealed prior to start of reinstallation. Install new bond breaker tape and sealant around the perimeter of the frames. Sealant work must be completed prior to installation of metal wall panels. 15. Work must be carefully sequenced between asphalt shingled roof system installation, perimeter sheetmetal flashings, trim, gutters, etc. and metal wall panel rainscreen to ensure proper installation and to maintain the roof system in a watertight condition. Refer to Section 015000 for additional requirements. 16. In areas where the underside of the deck is exposed, the Contractor shall coordinate with the Owner to provide temporary protection (loose plastic) over interior equipment, finishes, or contents that could be damaged by small dust/debris from roof replacement activities. Plastic should be removed at the end of the workday. 17. Provide and install other accessory or incidental components, or modify other roof features/items, not specifically listed or shown on drawings, but required for the complete and proper installation of the new roof system. 18. Roof system including membrane, flashings, and accessory components shall be installed in a watertight condition and with an overall quality of system installation that will allow the membrane and flashings to continue to perform in a watertight condition, with reasonable maintenance, over its manufacturer warranty period. Note: - Provide construction fencing installed around the perimeter of the project staging and storage limits as defined on the site plan. The fence shall be constructed of heavy-duty chain link materials, have a minimum height of six feet and shall have a continuous top tubular rail. The fencing must use non-penetrating posts set in weighted bases. Swing gates shall be included at every access to the enclosed area. When the project is complete, fencing must be removed and ground contours restored to original condition. - Provide overhead protection for the entrances/egress from the building. - A hot work permit may be required and the contractor must follow all permit requirements. If a hot work permit is required, a fire watch will be required. - The workers may not have contact with the building occupants. - No offensive decals/logos are to be worn on clothing or shown on vehicles. - The use of tobacco products is not allowed on the campus. - Notify Designer and Owner a minimum of 48 hours before manufacturer’s visit. - Contractor shall provide a foreman or a representative from the Contractor that is in a supervisory position that is familiar with the installation of the new roof system and who will be on the site anytime that work by the Contractor or one of his Subcontractors is in progress. The Contractor must provide a representative that is fluent in English on-site at all times DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.4 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 when work is in progress to ensure that the Owner and Designer can communicate with the crew members as needed during construction. B. The technical specifications and drawings provided are for communicating design intent. It is the responsibility of the Contractor to examine the technical specifications and drawings, and the site, and become familiar with and verify the existing conditions, specified design intent, and other conditions necessary for an accurate proposal and execution of the work. Any discrepancies discovered should be brought to the attention of the Designer for clarification or correction. 1.02 COORDINATION AND CONTRACTOR USE OF PREMISES A. The Owner will occupy the premises during the period of construction for the conduct of normal operations. Limit the use of the premises for construction operations, to allow for Owner occupancy to the building and adjacent buildings through the duration of the project. Contractor shall schedule and coordinate work with the designated points of contact at Orange County Asset Management and within the building. B. For the purpose of bidding, acceptable work hours shall be Monday-Friday between 6:00 a.m. and 8:00 p.m. The Orange County Project Manager must be notified in advance of work on weekends or outside of the hours listed above to allow for coordination and approval. This anticipated schedule is provided for general planning and does not eliminate the requirement for the Contractor to coordinate with the Owner to limit disruption to potential interior functions/use. C. The Contractor must follow all requirements of Orange County including, but not limited to, use of staging and storage areas as designated by the project documents, entrance to the site by workers and delivery vehicles, coordination to avoid significant noise disruption, and coordination of construction scheduling around the events of the building. Contractor shall not perform work if requested by the Owner due to special events at the building. Contractor shall receive additional contract time for time not permitted to work, but shall not receive additional compensation. D. Do not permanently block ingress and egress from the building. Maintain access that does not interfere with the Owner’s vehicular or pedestrian traffic, unless coordinated with the Owner. Where vehicular or pedestrian traffic will be rerouted or temporarily blocked, provide protective fencing and signage to safely redirect traffic as needed. E. Utilities are to remain undisturbed and in continuous operation, or provide alternate or temporary services acceptable to the Owner. Terminate no utility even for a short period without the prior approval from the Owner. The Contractor is responsible for the location and protection of existing utilities from damage due to construction. Repairs required due to damages to or outage of existing utilities must be immediately coordinated and paid for by the contractor. Where requested by the Owner, the Contractor must maintain a minimum 8’ clearance from specific equipment or utilities that may require Owner access. F. Parking and access to the site must be coordinated with the Owner’s representative. Designated limits for delivery trucks and other parking associated with the project will be defined at the pre- construction conference. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.5 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 G. Contractor shall provide a superintendent, foreman, or other representative from the Contractor that is in a supervisory position and fluent in English, who will be on the site anytime that work is in progress. If workers installing the roof are under subcontract and are not direct employees of the contractor, a representative or personnel in a supervisory position (Superintendent) directly employed by the Prime Contractor must be present full time anytime work is occurring on site. 1.03 PERMITS A. The Contractor shall apply for, secure and pay for all permits, governmental fees, inspections and licenses necessary for the proper execution and completion of the Work, which are applicable at the time that Bids are received. Contractor shall provide evidence of acceptance of work by submitting inspection forms from appropriate agencies indicating acceptance of work. 1.04 CONTRACT TIME AND SCHEDULING A. The contract time from the Notice to Proceed to project acceptance for Base Bid work is 75 days. The Notice to Proceed date is anticipated to be set as early as possible following execution of construction contracts. 1.05 BASE BID A. The Base Bid includes the following scope of work shown on the drawings and specified in the Project Manual: Roof replacement of all roof areas with new nailbase, underlayment, and shingled roof system and new exterior metal wall panels to form a rainscreen over the existing EIFS. B. The Base Bid shall also include the estimated quantities of work specified in Section 012100 of this Project Manual. 1.06 BID ALTERNATES A. Alternate Bid #1: Install a vented nailbase over the existing OSB in lieu of the standard nailbase, install associated vented details and flashings in accordance with the manufacturer’s requirements and the applicable sections of the specifications and detail drawings. 1.07 REFERENCE STANDARDS A. For products specified by association or trade standards, comply with the requirements of the latest standard, except when more rigid requirements are specified or required by applicable codes. B. Install items necessary to ensure compliance with the most recent adopted edition of the North Carolina Building Code whether or not shown on project drawings or specifically indicated in the technical specifications. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 010100.6 –SUMMARY OF WORK Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 1.08 DESIGNER’S SITE VISITS A. Designer or site representative will perform periodic visits to the site to observe Contractor activities and note non-conformance with the specifications to the Owner and Contractor. Non- conformance items must be corrected by the Contractor prior to approval of payment. B. Contractor shall cooperate with the representatives and personnel of the Designer to provide safe means and facilities for the Designer to observe all parts of the work for the purpose of determining conformance/non-conformance with the specifications. C. Contractor must notify the Designer a minimum of 48 hours prior to specific activities for which the Designer wishes to be present. The applicable activities will be defined by the Designer during the Pre-Construction Meeting, but are anticipated to include first day of removal and replacement on main roof areas or installation of specific details. If Contractor fails to notify the Designer to allow for observation, Designer may request to observe work, including covered work, to confirm conformance with the contract documents at no additional cost to the Owner. PART 2 PRODUCTS – NOT USED PART 3 EXECUTION – NOT USED END OF SECTION 010100 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 012100.1 – BASE BID ALLOWANCES (ESTIMATED QUANTITIES) Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 012100 BASE BID ALLOWANCES (ESTIMATED QUANTITIES) PART 1 GENERAL 1.01 SUMMARY A. This Section includes requirements governing estimated quantities of work to be included within the Base Bid cost and the associated unit prices requested to aid in reconciliation between quantities estimated and actual work performed. Refer to Section 010100 for additional information regarding Base Bid scope of work. B. Refer to specification sections 061000 and 073113 for technical requirements regarding base bid allowance (estimated quantity) work. 1.02 SUBMITTALS A. Provide submittals for products to be repaired, removed, and or installed as a part of the work in accordance with Section 013300 and the technical specification sections in which they are specified. 1.03 ESTIMATED QUANTITY WORK A. Estimated quantities are provided below for replacement of materials discovered to be deteriorated, damaged, missing, and/or installation of additional work that is not specifically designated in the specifications, but may become necessary. The cost to perform the estimated quantity of each work item listed below shall be included within the Base Bid. Work Item Estimated Quantity 1. Wood Blocking Replacement per Section 061000 500 BD FT 2. Oriented Strand Board Replacement per Section 061000 640 SQ FT 3. Supplemental Fastening of OSB per Section 073110 12 PER 100 4. Exterior Sheathing Replacement per Section 073110 200 SQ FT 5. Tectum E plank replacement per Section 061000 1 EA 1.04 UNIT PRICES FOR ESTIMATED QUANTITY WORK ITEMS A. A unit price for each of the estimated quantity work items listed above is requested on the Form of Proposal. Unit prices provided by the Contractor will be used for the purpose of adding or deducting from the Contract Sum by Change Order in the event that the actual performed amounts of each estimated quantity work item listed in Paragraph 1.03A are more than, or less than, the estimated quantity included in the Base Bid. B. The unit prices provided on the Form of Proposal shall include all costs associated with the work including, but not limited to, removal of materials to be replaced, preparation of substrates and adjacent surfaces for associated installation, and material, labor, overhead and profit, insurance, taxes, shipping costs, accessory items/equipment/tools. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 012100.2 – BASE BID ALLOWANCES (ESTIMATED QUANTITIES) Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 PART 2 PRODUCTS - Not Used. PART 3 EXECUTION - Not Used. 3.01 PREPARATION AND INSTALLATION A. Prepare, supply, and install products associated with estimated quantity work in accordance with the technical specification sections in which they are specified. 3.02 DOCUMENTATION OF ESTIMATED QUANTITY WORK A. A representative of the Owner and/or Designer should be made aware when work items performed as a part of the estimated quantity work are anticipated, unless otherwise agreed upon during the pre- construction meeting. B. Documenting and tracking of actual estimated quantity work performed is the responsibility of the Contractor is important to allow for comparison with estimated quantities during work progress and a proper reconciliation of contract work at project acceptance. The Designer/Owner may deny payment for work performed by the Contractor if adequate documentation of work performed cannot be provided. At minimum, photographic documentation of the existing condition requiring estimated quantity work, removal of existing materials, and installation of replacement materials will be required if direct observation by the Engineer or Owner is not possible. END OF SECTION 012100 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 012500.1 – PROJECT MEETINGS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 012500 PROJECT MEETINGS PART 1 GENERAL 1.01 PRE-CONSTRUCTION CONFERENCE A. The Engineer will schedule and administer a Pre-Construction Conference upon award and execution of the contract. Representatives of the Owner, Engineer, Contractor, and representatives of other Governmental or regulatory agencies (as necessary) shall be in attendance. The Contractor’s Project Manager, anticipated Site Superintendent/Foreman, a representative of the roof system manufacturer, and applicable subcontractors shall be present at the Pre-Construction Conference unless otherwise discussed and agreed upon. Engineer shall distribute meeting minutes to all attendees. B. Suggested Agenda: Confirmation of the execution of Owner-Contractor Agreement, exchange and discussion of preliminary submittals and procedures, designation of key representatives and personnel, discussion of construction schedule and work sequencing, designated storage and parking areas, security and housekeeping procedures, maintenance of record documents, and technical material and installation information. 1.02 PROGRESS MEETINGS A. Engineer will schedule and administer progress meetings throughout progress of the Work at regular and appropriate intervals (For this project, meeting frequency will be every two weeks. If issues arise that require additional coordination, the Designer will schedule conference calls between progress meetings). B. Engineer will make physical arrangements for meetings, preside at meetings, record minutes, and distribute copies of the minutes to the Owner, Contractor, other meeting participants, and those affected by decisions made at meetings. C. Attendance: Contractor’s project manager, Contractor’s superintendent and foreman, major subcontractors and suppliers (as applicable), Owner’s representative, and Engineer. Additional attendees may be requested as appropriate to agenda topics for each meeting. D. Suggested Agenda: Review of work progress, status of progress schedule and contract sum and adjustments thereto, delivery schedules, submittals, maintenance of quality standards, pending changes and substitutions, and other items affecting progress of Work. PART 2 PRODUCTS - Not Used. PART 3 EXECUTION - Not Used. END OF SECTION 012500 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 013300.1 –SUBMITTALS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 013300 SUBMITTALS PART 1 GENERAL 1.01 PROCEDURES A. Make submittals required by the Contract Documents in a timely manner to allow for sufficient review and approval by the Engineer. Revise and resubmit as necessary to establish compliance with the specified requirements. Submit documents to Engineer electronically with Submittal Form SF-1 attached to document and consecutively numbered. An electronic version of SF-1 will be made available upon request. 1.02 WORK INCLUDED A. Electronic copies of submittals are preferred. Each submittal must be accompanied with a transmittal form as provided at the end of this section. For items that cannot be submitted electronically (large format shop drawings, physical samples, color charts or chips, shingle samples, etc.), deliver to the Engineer for review. Physical submittals must still be accompanied by a transmittal sheet. B. The Work may not proceed until the complete pre-job submittal package, including shop drawings, has been reviewed and approved by the Engineer. Update submittals to the Engineer during construction to account for new equipment, products, etc. used on the project. Engineer may elect to allow phased submittals to meet work schedule if agreed upon in advance with the Contractor. C. At the end of the project, submit a minimum of four complete sets of "Post-Job Submittals" to the Engineer for review, following the final acceptance of the Work. These submittals must be provided as hardcopies due to the types of documents involved. Requests for final payment will not be approved until the Post-Job Submittal package has been accepted by the Owner. Organize post-job submittals keyed to a list of items required under Article 1.04 of this Section. D. Identify individual submittals by product type or name on the submittal form and include a table of contents in each submittal package or transmittal email listing items included. E. Submittals listed in this Section and required by other Sections to be submitted in accordance with this Section are applicable. If in the opinion of the Contractor, an item listed is not applicable, the Contractor must submit documentation substantiating his position. Likewise, if a submittal is unavailable, the Contractor must submit documentation reconstructing the missing information as best as can be accomplished. 1.03 CONTRACTOR'S PRE-JOB SUBMITTALS A. The following material and product submittals shall be provided: 1. Product data for each material and product to be installed to confirm conformance with specified requirements or to provide information on additional products required for installation. 2. Product manufacturers’ installation instructions for each material and product to be installed. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 013300.2 –SUBMITTALS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3. Product SDS for each material to be installed and associated equipment/products to be used during installation. 4. Material samples of shingles, vented nailbase, metal wall panels, etc. to be used as requested by the Engineer. Material samples must have manufacturer’s product identification on the sample. 5. Color selection materials for pre-finished metal, sealants, shingles, or other products as noted in the applicable specification sections. Physical metal chip samples in addition to a color chart will be requested for pre-finished metal color selection. B. The following technical submittals shall be provided: 1. Detailed outline of the methods and means to be followed during the installation of the roof system. Once accepted, this outline may only be changed with written approval. Include procedures to keep roof areas dry through each stage of the construction process. Emergency contact numbers will be provided with plans for checking the building interior during rain events and maximum response times listed. 2. Shop drawings for details or constructions for the purpose of providing additional information, such as detail configurations and metal fabrication shapes and sizes, etc. Show securement patterns for the vented nailbase as well as perimeter and corner dimensions to meet code- required and specified wind uplift loads. If any details provided on the shop drawings vary from those shown on the project documents, the Contractor must note such variance on the submittal to indicate that a change is requested. The Engineer will review such requested revisions and will approve or reject at their sole discretion. 3. Certifications that materials to be installed are asbestos-free and are compatible with the substrates to which they will be applied. 4. Letter from the roof system manufacturer stating that the Contractor (or subcontractor when applicable) is an approved applicator of its roof system as specified. 5. Letter from the roof system manufacturer indicating review of the project documents, acceptance of design intent and details as shown, and intent to issue the specified warranty, including acknowledgment of any warranty modifications specified. Refer to Section 014000 for additional information. Letter must be project specific and shall include the type and duration of warranty, riders, any manufacturer’s additional requirements, and a sample copy of actual warranty; including materials and weathertightness as applicable. 6. A sample copy of the Contractor’s Five-Year Warranty. 7. Pre-Job Damage Survey in accordance with Section 024110 of this Project Manual. 8. Additional submittals as requested in each section. C. The following administrative submittals shall be provided: 1. Building permits as required by the federal, state or any local entity for the construction or demolition work required during the progress of the Work. If no permits are required, so state. 2. Proposed preliminary progress schedule for the Work. Revise and submit progress schedule as necessary. Review Owner requirements for progress schedules. Progress schedules should include line items for specific work activities at each roof area or group of areas with both schedule dates for the line item and a graphical representation of those dates along with a line to compare actual schedule progress. 3. Schedule of Values for the project. Work Items shall be generally divided by Project Manual Section and into materials and labor cost. Copies of invoices/quotes from supplier for materials may be requested to ensure that material costs listed are not significantly increased in comparison to labor costs. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 013300.3 –SUBMITTALS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 4. Insurance certificate issued to Owner by Contractor's insurance carrier listing required coverage (if not already required for submittal as a part of execution of the construction contract.) 5. Written security plan, if required by the Owner. 6. Contractor Safety Program, specifically designed for this project that recognizes and mitigates the specific hazards present in performing the Work. 7. Provide a list of any subcontractors to be utilized in performance of the work. Submit information regarding the subcontractors including contact information, copies of licenses/certifications, and references (if requested). 1.04 CONTRACTOR'S POST-JOB SUBMITTALS A. Provide all original copies, unless otherwise noted, of each of the following post-job submittals: 1. Final Application for Payment (5 original copies) 2. Consent of Surety to Final Payment (if applicable) 2. Contractor’s Affidavit of Release of Liens (properly signed, notarized, etc.) 3. Properly executed release of liens by subcontractors and/or vendors 4. Certification letter that no asbestos containing materials were used. 5. Final list of all subcontractors and suppliers with names, addresses, and phone numbers 6. Specific operating and maintenance manual(s) for the new roof system and components. 7. Duplicate, notarized copies of the Contractor’s 5-year and two originals of the Manufacturer’s warranty. Product and project warranties requiring Owner’s signature are not acceptable. (Lengths of shingle warranties vary – see Section 073113 for additional information) 8. One set of as-built drawings- including a copy of both design and shop drawings with changes clearly marked (Red-Lined Drawings). PART 2 – PRODUCTS – Not Used PART 3 - EXECUTION 3.01 IDENTIFICATION OF SUBMITTALS A. Number consecutively and clearly identify submittals. Submittal Form (SF-1) must accompany each submittal package provided. This form will be provided electronically if requested. Show identification on at least the first page of each submittal, and elsewhere as necessary for positive identification of the submittal. 1. When material is resubmitted, cite the original submittal number for reference and add a suffix such as "-A, -B" (2-A, 2-B, etc.). B. Maintain an accurate submittal log for the duration of the Work, showing current status of all submittals. Make the submittal log available to the Owner’s representative for their review. C. Keep one approved set of design and shop drawings, specifications, and submittals (including data sheets, instruction sheets, etc.) at the job site. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 013300.4 –SUBMITTALS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3.02 TIMING OF SUBMITTALS A. Make submittals far enough in advance of scheduled dates of Notice to Proceed, and the start of work or installation of specific products to provide time required for review by the Engineer, for securing necessary approvals, for possible revisions and resubmittals, and for placing order and securing delivery of materials. B. In scheduling, allow a minimum of ten (10) working days from date of Engineer’s receipt of the submittal for his review. C. Contractor accepts responsibility for delays resulting from incomplete or late submittal packages. D. Work completed without approved submittals may be subject to rejection. 3.03 DESIGNER'S REVIEW A. Partial submittals may be rejected for non-compliance with the Contract Documents. B. Review by Designer does not relieve Contractor from responsibility of conforming to the technical specifications and drawings or for errors which may exist in the submitted data. C. Revisions: 1. Make revisions when required by Designer and resubmit for review. 2. If the Contractor considers any required revision to be a change, he shall so notify the Designer as provided for in the article for "Changes in the Work" of the General Conditions. 3. Make only those revisions directed or approved by the Designer. D. The Engineer will provide an initial review and up to two subsequent reviews of each required submittal. Submittal reviews in excess of this due to incomplete submittals or failure to address review comments may result in additional cost to the Owner. The Owner reserves the right to require reimbursement of this additional cost by the Contractor. 3.04 CLAIMS FOR EXTRA COST: No claim for extra cost shall be approved solely based on work shown on shop drawings unless such claim is made on the Contractor's letter of transmittal accompanying the shop drawings and is approved by the Owner in writing. END OF SECTION 013300 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E SUBMITTAL TRANSMITTAL FORM (This Form Must Be Physically Attached To Each Submittal And Must Be Numbered Consecutively) Project Name: Motor Pool Roof Replacement Code: Contractor Name: Specification Section Number: Subcontractor: Product Type: Product Trade Name: Major Supplier Applicable Drawing or Detail: Remarks: Submittal Identification (Use Unique I.D. for Attachment) Submittal Number: Date of Submittal: SEAL Contractor Seal: I have reviewed the attached submittal and it complies with the requirements of the General Conditions and other applicable sections of the Contract Documents. Signature of Contractor FOR DESIGNER'S USE ONLY DATE RECEIVED: DATE RETURNED: ATLAS Job No.: J2400 -No corrections noted -Make corrections noted -Revise and resubmit -Not acceptable - see remarks Review is only for general conformance with the design concept of the project and general compliance with the information given in the contract documents. Contractor is responsible for compliance with contract documents, confirming and correlating all quantities and dimensions, selecting fabrication processes and techniques, including means, methods, and sequencing of construction, coordinating the work with that of all other trades, and performance of the work in a safe and satisfactory manner. Corrections Noted: Remarks: ATLAS ENGINEERING, INC. BY: DATE: SF-1 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 014000.1 – QUALITY CONTROL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 01400 QUALITY CONTROL PART 1 GENERAL 1.01 SUMMARY A. Maintain quality control over suppliers, manufacturers, products, services, site conditions, and workmanship, to produce Work of specified quality. 1.02 CONTRACTOR WORKMANSHIP A. The Installers of the asphalt shingle roof system, and metal wall panels must be approved/certified applicators of the manufacturer systems/products to be installed. The certification/approval must be provided by the manufacturer and must be based on installation training, contractor experience with the system, and installation performance and technical observation, not solely on sales ranking. Approval/certifications must have been in place prior to the bid date. The prime contract shall either be approved themselves, or shall use approved subcontractors to perform the work on this project and shall list them on the Form of Proposal. Certification/approval may be requested for the purpose of reviewing and evaluating bids and failure to provide requested documentation may result in disqualification of bid. B. The bidding contractor shall have been in business a minimum of five (5) years prior to the date of bid and must have (or utilize a subcontractor who has) a minimum of 5-year’s prior experience with installation of the specified roof system(s) on commercial or public buildings. Upon request, Contractor must be able to provide documentation of age of business, and of completed projects of the same system (with similar size and scope). This documentation may be requested for the purpose of reviewing and evaluating bids and failure to provide requested documentation may result in disqualification of bid. C. Roof system including shingles, underlayment, nailbase, flashings, metal wall panels, and accessory components shall be installed in a watertight condition and with an overall quality of system installation that will allow the membrane and flashings to continue to perform in a watertight condition, with reasonable maintenance, over the system manufacturer warranty period. Work must be performed by persons qualified to produce workmanship of the above quality. Project Manager and Project Superintendent must have specific experience with the system(s) to be installed and on projects of similar size and complexity. D. Contractor must maintain the same Project Manager and Superintendent throughout the project duration unless a change is reviewed by and agreed upon by the Owner. The Contractor must replace the Project Manager or Superintendent if specifically requested by the Owner due to concerns with quality of workmanship or inattentiveness to the requirements of the project. If work is being completed by a subcontractor, the prime contractor must have a representative present on site while subcontracted work is underway. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 014000.2 – QUALITY CONTROL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. For the purpose of safety and communication, the Contractor shall have a minimum of one bilingual person on site at all times if any crew member to be present on-site does not speak fluent English. Designated translators must have identification of this role clearly visible while on site. 1.03 MANUFACTURER’S SERVICES AND INVOLVEMENT A. The Contractor shall be responsible for providing the design documents to the manufacturer to allow for review and approval regarding design intent and to confirm ability of their system to meet specified requirements and specified system warranty prior to provision of a bid for the project. Failure of a particular roof system to meet the requirements of the specifications, or failure of the manufacturer to provide intent to warranty for the project may result in the requirement for the Contractor to utilize another conforming roof system manufacturer’s products at no additional cost to the Owner. B. Comply with the manufacturer’s installation instructions, including each step in proper sequence. Should manufacturer’s instructions or detail requirements be less stringent that the Contract Documents, use the more stringent requirements. If the manufacturer’s instructions or detail requirements conflict with the Contract Documents, request clarification from the Engineer before proceeding. 1.04 ENGINEER’S CONSTRUCTION OBSERVATIONS A. Contractor shall notify Engineer weekly of significant project activities. Contractor must notify Engineer a minimum of 48 hours prior to specific activities for which the Engineer wishes to be present. The applicable activities will be defined by the Engineer during the Pre-Construction Meeting, but may include first day of tear-off and replacement on specific roof areas or installation of specific details, and independent inspections or testing by the manufacturer or other parties. If Contractor fails to notify Engineer to allow for observation, Engineer may request to observe work, including covered work, to confirm conformance with contract documents at no additional cost to the Owner. B. Contractor shall provide reasonable access, personnel and equipment required by Engineer to observe the Work. 1.05 WARRANTY AND GUARANTEE A. Provide a Contractor’s Five-Year Warranty for all of the work included in this project. The Contractor shall warrant workmanship, materials, and weathertightness of the roof system against defects due to faulty materials, poor workmanship, or work not installed in conformance with project technical requirements or level of quality as required by the general and supplemental conditions. Warranty must cover repair of distresses that are discovered in the roof system or other installed work whether or not they are actively causing water entry into the system or building. The warranty will extend for a period of sixty (60) months from the date of Final Completion. The provided warranty shall be in addition to and independent from the roof system manufacturer’s warranty. The Contractor shall include language in the warranty setting the maximum response time to a warranty complaint by the Owner to 24 hours for emergency conditions and five (5) working days for non- emergency conditions, unless otherwise agreed upon by the Owner. Refer to specific sections of this specification for any additional warranty requirements. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 014000.3 – QUALITY CONTROL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 B. Install roofing systems to allow for issuance of manufacturer’s warranties as required by specific sections of these specifications. C. When specified in respective Specification Sections and/or required to obtain specified system warranty, require the manufacturer to provide qualified personnel to observe field conditions, conditions of surfaces and installation, quality of workmanship, as applicable, and to make appropriate recommendations. A minimum of 4 visits to the site (plus 1 final/warranty inspection) by the roof system manufacturer’s technical representative are required. Representatives of the manufacturer shall submit written reports observations and recommendations during field services. A copy of the manufacturer’s report must be provided to the Engineer within 2 days of receipt by the Contractor. D. Should workmanship samples or specific system testing be required by the manufacturer issuing a warranty, contractor shall provide such testing or sampling. If, for any reason, deficiencies are found within the system during sampling or testing, the Contractor shall, at his expense, make repairs and replacements as necessary, to correct deficiencies and satisfy the requirements of the manufacturer issuing the warranty. PART 2 PRODUCTS - Not Used. PART 3 EXECUTION - Not Used. END OF SECTION 014000 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 015000.1 - CONSTRUCTION FACILITIES Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 015000 CONSTRUCTION FACILITES PART 1 GENERAL 1.01 SITE CONDITIONS AND PRE-JOB DAMAGE SURVEY A. The Contractor is to accept the building “as is” and shall exercise care to protect existing utilities, site, and building components. Verify existing conditions and notify Owner and Designer should the conditions vary significantly from those described in the technical specifications and drawings. Should minor conditions be encountered which are not exactly as indicated, modification to accommodate new work shall be made as required at no additional cost to the Owner. B. The Contractor shall perform and submit a Pre-Job Damage Survey to document existing conditions and specific damages/defects to existing building or building components. Pre-Job Damage Survey shall be provided in accordance with Section 024110 of these specifications and must be completed prior to the start of staging, storage, or material delivery to the site. 1.02 TEMPORARY FACILITES A. Temporary Water: Water for construction will be furnished by the Owner from existing facilities if exterior connections are available, functioning, and adequate for use. Required connections and extensions for temporary use shall be provided by the Contractor from a point designated by the Owner. Temporary connection to existing water must be turned off and disconnected with not in use or when Contractor is not on site. Abuse of water privilege shall be grounds for cancellation of same by Owner. Contractor will be responsible for providing water if existing facility connections do not exist, are not functioning, or are inadequate for the needs of the Contractor during the project. If provision of temporary water is critical to installation or proper equipment function, the Contractor is responsible for confirming existing availability prior to bidding and should provide, as a part of his work and within his Base Bid, any supplemental water required for proper installation of the work. B. Temporary Power: Power for construction will be furnished by the Contractor unless otherwise agreed upon by the Owner. If the Owner agrees to provide temporary power, and existing exterior power supply is adequate for required equipment and installation, the required connections and extensions for temporary use shall be provided by the Contractor from a point designated by the Owner. The Contractor shall provide required distribution boxes, grounding requirements and breaker protection. Contractor shall be responsible for the coordination and cost of any required inspection of temporary power components. Abuse of power privilege shall be grounds for cancellation of same by Owner. C. Toilet Facilities: Provide temporary toilet facilities meeting the requirements of the Health Department with authority. Contractor’s personnel shall not use Owner’s toilet facilities. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 015000.2 - CONSTRUCTION FACILITIES Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. Sanitary Facilities: Provide temporary containers to dispense drinking water and general washing facilities for construction personnel meeting the requirements of the Health Department with authority. Contractor’s personnel shall not use Owner’s restroom facilities. E. Existing Utilities: On-site underground utilities shall be located and marked by an independent locating service at the Contractor’s expense. Location and marking are necessary if excavation work will be performed or if heavy equipment, vehicle, or other construction traffic will occur over portions of the site. Contractor shall pay for damage to interruption of any utility service due to construction activities. 1.03 ACCESS TO THE SITE A. Access to the site and parking may be restricted to storage and staging areas as designated on the design drawings or as otherwise required by the Owner. Provide all Contractor employees with visible identification (badges, shirts, or hardhats) bearing the name of the Contractor and/or employee. Employees not displaying identification may be required to leave the site. B. Contractor’s personnel shall coordinate with the Orange County Asset Management point of contact prior to performing work on the building interior. Contractor’s personnel shall only communicate with designated personnel at the site. Conduct by the Contractor’s personnel that causes any complaint will result in the permanent removal of the offending individual(s) from the site. 1.04 PROTECTION AND RESTORATION A. Perform a Pre-Job Damage Survey prior to the start of construction in accordance with Section 024110 of this Project Manual. Protect existing building, adjacent buildings, walkways, grass areas, landscaping, paved and concrete parking lots, brick pavers, and other site features and equipment from damage as a result of construction operations. Any damaged items or conditions not documented in the Pre-Job Damage Survey to have been existing prior to the start of construction, shall be considered to have been damaged by construction activities and shall be restored to their original condition, or replaced, at no cost to the Owner. Whenever demolition, patching or restoration is required for completion of the work, provide protection of site and building features regardless of being shown or not shown on the drawings. Repair of grass areas, walkways, landscaping and other site features damaged by construction activities shall be performed to the satisfaction of the Owner to meet the condition of the feature prior to construction activities. It is recommended that the Contractor discuss expectations for landscaping and grass repair, and/or sodding with the Owner during bidding, and prior to the start of work. B. Protect interior finishes, equipment and other building user property located inside the building as necessary. Contractor shall be responsible for damages resulting from construction activities including damages to interior finishes, County property, and personal property of building occupants within the building. In areas where the underside of the roof deck is exposed to the interior, the Contractor must place temporary protection (loose plastic) over interior contents in the area(s) directly beneath the roof area to be removed. Plastic should be removed at the end of the workday. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 015000.3 - CONSTRUCTION FACILITIES Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 C. Provide temporary weather and debris protection at all locations where existing building materials are removed. Contractor shall be responsible for damages resulting from inadequate protection and entry of water, debris or other items into the interior spaces. Refer to specific roof system specification sections for additional requirements for weathertightness during construction. D. Provide barriers around trees, plants and ground-mounted equipment. Tree protection fencing must be installed at all trees located in the general vicinity of staging and storage, anticipated equipment traffic routes, dumpsters and other construction activities unless otherwise agreed upon with the Owner’s representative. Protect trees, landscaping, grass areas and other site vegetation against vehicular traffic, stored materials, chemically injurious materials, and puddling or continuous running water. E. Comply with OSHA and other applicable safety regulations. Contractor shall be solely responsible for the safety and health of its employees. F. Provide temporary protection against damage of both stored and installed products. Damaged materials or products shall be removed from the site and replaced at no cost to the Owner. G. Limit traffic and storage to areas located on the site plan and agreed upon by the Owner’s representatives. H. Roof replacement must be sequenced to limit foot and equipment traffic over areas of new roof system installation. Where foot and equipment traffic over the existing roof system is unavoidable, provide protective walkways or other methods to adequately protect the new materials. The Contractor is responsible for leaks in the existing roof system caused by or exacerbated by construction traffic. 1.05 SITE CLEANING A. Clean debris from construction activities daily at minimum, and directly following the end of a work shift. Place debris in closed containers for removal from the site. B. Clean up shall include removal of mud, oil, sand, dirt, trash, scrap, debris, and excess materials from any areas outside of designated and barricaded storage area. C. Cleaning of site and removal of debris shall be to the satisfaction of the Owner. Windy conditions that cause blowing of materials or debris may require the Contractor to put in place more restrictive cleaning and protection requirements. 1.06 STORAGE AREA A. Limited storage and staging area will be provided on site as shown on the project drawings and coordinated with the Owner. It is the Contractor’s responsibility to adequately secure stored materials and equipment. Install chain link fencing around the main staging and material storage area. Fencing should include necessary gates. Chain link fencing installed shall be a minimum of 6’ tall, have movable bases and shall not be installed such that existing concrete or asphalt surfaces are damaged. At isolated staging and access areas, provide 3’ tall orange snow fencing surrounding the perimeter of the area. Fencing must have movable bases if located on concrete or DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 015000.4 - CONSTRUCTION FACILITIES Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 asphalt. Alternate fencing must be discussed with and agreed upon by the Owner. Remove evidence of use and leave area and entire limits of site clean upon completion of the project. Restore areas damaged by stored materials to original condition. B. Contractor shall load materials onto the roof when areas below loading area are unoccupied by building occupants unless otherwise coordinated with the Owner. It is the responsibility of the Contractor to space materials stored on roof such that they do not overload the existing roof deck and structure. Storage of materials on the roof surface shall be limited to those expected to be installed within 5-7 work days unless discussed with and agreed upon by the Owner and Designer. C. Contractor shall not stockpile removed materials on site. D. The Contractor is responsible for scheduling delivery of materials to the site to allow for continued work and taking into consideration the size and location of storage area. Contractor shall obtain and pay for use of additional storage or work areas if needed for operations under this Contract. E. No Contractor sign or advertisement shall be allowed to be displayed without the Owner and Designer’s approval. PART 2 PRODUCTS – NOT USED PART 3 EXECUTION – NOT USED END OF SECTION 015000 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 016000.1 – MATERIALS AND EQUIPMENT Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 016000 MATERIALS AND EQUIPMENT PART 1 GENERAL 1.01 TRANSPORTATION AND HANDLING A. Provide equipment and personnel to handle products by methods to avoid product damage. Deliver products in undamaged condition in the manufacturer’s unopened and marked containers or packing. B. Promptly inspect shipments to assure that products comply with specified requirements, quantities are correct, and products are undamaged. 1.02 STORAGE AND PROTECTION A. Store products in accordance with the manufacturer’s instructions, with seals and labels intact and legible. Products requiring fire resistance classification shall be delivered and stored with labels attached and packaged as required by labeling. B. For exterior storage of products, place on sloped supports above the ground. Cover products with impervious sheet covering and provide ventilation to avoid condensation. Maintain temperature and humidity ranges required by the manufacturer for each product. C. Store loose or granular materials on solid surfaces in a well-drained area and prevent mixing with foreign matter. D. Arrange storage to provide access for inspection. Periodically inspect materials to assure products are undamaged and are maintained under required conditions. E. Select and operate material handling equipment so as not to damage existing construction and/or materials. Protect materials against construction traffic. F. Materials that are damaged or that become saturated shall not be used and shall be removed from the project site. The Designer reserves the right to mark damaged or wet materials and require immediate disposal/removal of material. G. Handle bundled shingles so as to prevent damage. Store bundles flat in accordance with the product manufacturer’s recommendations. H. The Contractor shall not load more materials on the roof than can be installed within 5-7 working days, unless otherwise approved. Materials shall be distributed and not stacked. Gasoline storage containers, open cleaners, or other flammable or volatile materials shall be removed from the roof daily. I. Payment by the Owner for any materials, equipment or labor incorporated in the work shall not be deemed to be an acceptance by the Owner. The risk of loss of such materials, equipment or cost of labor spent to install such, shall remain with the Contractor. Stolen, damaged, vandalized, missing, or weather-damaged equipment, material, and work shall be considered the property of the Contractor until final acceptance of the project by the Owner. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 016000.2 – MATERIALS AND EQUIPMENT Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 J. No payment by the Owner will be made for any material not physically located on the site unless the storage of such material can be verified by the Designer and is marked specifically for the project use and scheduled for installation within 30 days of payment request. 1.03 SUBSTITUTIONS AND PRODUCT OPTIONS A. Products Specified by Reference Standards or by Description Only: Provide a product meeting those standards. The Owner and Engineer reserve the right to require confirmation by the roof manufacturer that their system/products intended for use meet the requirements of the specifications prior to award of the contract. Failure of the contractor to provide requested confirmation may result in disqualification of their bid. B. Products Specified by Naming Several Manufacturers: Provide a product of named manufacturers meeting specifications: Requests for product substitutions must be made in writing for any manufacturer not specifically named in accordance with the following requirements in paragraphs 1.03C, D, E, F, and G. When a minimum of three approved manufacturers/products are listed, the Engineer reserves the right to not accept any requests for manufacturer/system substitutions. C. If the Engineer will allow requests for substitution of the roof membrane/system and manufacturer from those listed in the applicable section of these specifications, requests must be submitted no less than ten (10) days prior to the bid date. Requests must be made by the Contractor, requests from suppliers or manufacturers will not be reviewed. D. Each written request for a substitution shall be submitted with complete data substantiating compliance of proposed substitution with the technical specifications and drawings. A chart comparing the warranty, technical data, etc. comparing the two materials must be submitted. E. The request shall constitute that the Contractor: 1. Has investigated the proposed product and determined that it meets or exceeds, in all respects, specified product. 2. Will provide the same warranty as the specified product. 3. Will coordinate installation and make any other change that may be required for work to be complete with substituted item. 4. Waives claims for additional costs that may subsequently become apparent due to use of substituted item. F. Substitutions will not be considered when they are included without identification as a substitution or implied on shop drawings or product data submittals without separate written request, or when acceptance will require substantial revision of technical specifications. G. The Designer will determine acceptability of proposed substitution, and will notify the Contractor of acceptance or rejection in writing within a reasonable time. PART 2 PRODUCTS – NOT USED PART 3 EXECUTION – NOT USED END OF SECTION 016000 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 017700.1 – PROJECT CLOSEOUT Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 017700 PROJECT CLOSE-OUT PART 1 GENERAL 1.01 SUMMARY A. When Contractor considers Work to have reached completion, submit written certification that Contract Documents have been reviewed, the Contractor has inspected Work, and that Work is complete in accordance with Contract Documents and ready for Engineer's inspection. For the purpose of requesting a pre-final inspection, “completion” is defined as the performance of all of the work items listed in the Project Manual and as required for proper installation of the roof system. B. Designer shall make one pre-final inspection during which a list of incomplete items, or items requiring repair (punchlist) will be compiled. Upon completion of punchlist items, the Contractor submit in writing that completion of the punchlist items has been confirmed by the Contractor and is ready for the Designer’s final inspection. The Designer will perform the Final Inspection to confirm completion of outstanding punchlist items. C. If the Contractor fails to complete contract on time, the Owner reserves the right to assess liquidated damages in accordance with the Supplementary Conditions of the Contract. D. If the Contractor fails to complete contract on time, additional restrictions from the Owner to work schedule, noise, storage, staging, and other site and building restrictions may apply. E. In addition to post-job submittals required by Section 013300, provide any submittals required by governing authorities, and submit a final statement of accounting giving total adjusted Contract Sum, previous payments, and sum remaining due. F. Designer will issue a final Change Order reflecting approved adjustments to Contract Sum not previously made by Change Order. 1.02 FINAL CLEANING A. Execute final cleaning of the roof membrane surface and all components prior to performance of the Pre-Final inspection. Execute final cleaning of the site and punchlist repair areas prior to requesting the final inspection. B. Clean interior and exterior surfaces exposed to view; remove temporary labels, stains and foreign substances. C. Clean site; sweep paved areas, rake clean other surfaces affected by the work, storage or access. Contractor may be required to re-sod areas of grass that are killed/damaged as a result of construction activity if required by the Owner to return site conditions to their original condition. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 017700.2 – PROJECT CLOSEOUT Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. Remove waste and surplus materials, rubbish, and construction facilities from the Project and from the site. 1.03 PROJECT RECORD DOCUMENTS A. Keep a record document set on site stored for protection from construction activity. B. Keep record documents current; do not permanently conceal any changed work until required information has been recorded. C. At Contract close-out, submit record documents (as-built drawings) as indicated in Section 013300 with transmittal letter containing date, Project title, Contractor's name and address, list of documents, and signature of Contractor. Record drawings with handwritten red-line mark-ups are acceptable for submittal to fulfill this requirement. 1.04 OPERATION AND MAINTENANCE DATA A. Provide data for roof systems and other installed equipment in accordance with Section 013300. 1.05 WARRANTIES AND BONDS A. Provide required contractor and manufacturer’s warranties in accordance with Section 013300. PART 2 PRODUCTS - Not Used. PART 3 EXECUTION - Not Used. END OF SECTION 017700 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 024110.1 – SELECTIVE DEMOLITION Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 024110 SELECTIVE DEMOLITION PART 1 GENERAL 1.01 WORK INCLUDED A. Perform a Pre-Job Damage Survey prior to the start of work on-site including mobilization of equipment, material delivery, and set-up of storage and staging areas. B. Water test underground drain lines prior to the start of demolition for roof replacement to confirm that they appear to be in working order (not clogged or damaged in a way that causes the back-up or slow flow of draining water from downspouts). C. Provide labor, materials, equipment, and supervision necessary to perform selective demolition, which includes, but is not limited to the following: a. Remove existing asphalt shingles, underlayment, perimeter edge metal, gutters, fascia, soffit, downspouts, and support framing at the soffit/overhang to expose the existing oriented strand board substrate. Care must be taken to avoid damage to the existing substrate during removal of the existing roofing. Sequence the work so that crews do not remove more of the existing roof system than can be maintained in a watertight condition prior to the end of each workday. Removed materials should be disposed of legally off-site unless otherwise agreed upon with the Owner. b. Remove the EIFS (coating and insulation) to expose the sheathing along transitions with the adjacent shingled roof system and directly below all window/louver assemblies on the south elevation. c. Protect components that will remain for reuse, including, but not limited to, nailable substrate, portions of wood blocking, portions of the EIFS, sheathing, masonry walls, windows, penetrations, louvers, etc. d. Inspect the existing oriented strand board substrate, wood blocking, sheathing, and other components noted to remain. Make repairs to, or replace, damaged or deteriorated materials in accordance with applicable sections of these specifications. Protect and reuse existing wood blocking and cold-formed framing only where shown on the design details or when specifically approved on-site by the Designer. Otherwise install new materials. Inspect the securement of the existing oriented strand board and install supplemental fasteners in accordance within applicable sections of these specifications to provide wind uplift resistance in accordance with the North Carolina State Building Code and ASCE-7. Refer to base bid allowances (estimated quantities of work in Section 012100) for additional information. e. Inspect roof penetrations and raise/extend penetrations as needed so they will maintain a minimum 8” vertical flashing height above the shingled roof at the new roof thickness. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 024110.2 – SELECTIVE DEMOLITION Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 Extend/modify any mechanical connections, ductwork, etc. as necessary to raise penetrations to required heights. D. Provide other demolition whether or not indicated on the drawings or in the specifications as required to perform proper installation of the specified roof system and associated components. 1.02 PRE-JOB DAMAGE SURVEY A. Contractor shall perform a pre-job damage survey of the rooftop equipment and features, building exterior, site, pavements, and building interior to document existing damaged conditions prior to beginning work. B. Contractor shall submit required documentation, including either video tape footage of the survey and/or photographs and sketches, as necessary to adequately describe the location of existing conditions and defects and to verify the date of the survey. C. The Owner and/or Engineer will not review and approve items documented in the Contractor’s pre-job damage survey unless specifically requested by the Contractor. D. The Contractor shall be responsible for repair or replacement of materials that are damaged during construction activities and are not documented to have been existing prior to beginning the work. Items/materials that are damaged shall be returned to their original condition prior to construction activities. If return to original condition is not possible/practical, Contractor shall replace item/material with new as approved by the Engineer and the Owner. 1.03 PROTECTION A. Limit size of work sections to safeguard adjacent materials, structures, etc. and to minimize dust, noise, and water damage. B. Protect existing site and facilities from damage during work. Do not overload existing paving, curbs, sidewalks, etc. with vehicle traffic. Do not overload new or existing construction with demolition debris, equipment, etc. C. Material and debris shall be transported to and from the roof by crane, hoist, or forklift. The equipment shall be operated by a certified operator. D. Damage shall be repaired at the Contractor's expense. E. Contractor shall furnish necessary temporary protection from weather at all areas of demolition to protect interior of building from elements of weather at all times. Install specified roof system(s) and tie in to existing roof system as needed to make roof watertight daily. F. Debris will not be allowed to accumulate on the roof or on-site. Debris shall be removed from the roof daily. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 024110.3 – SELECTIVE DEMOLITION Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 G. The Contractor shall not load more materials on the roof than can be installed that day, unless otherwise approved by the Owner or Owner’s represented. Materials shall be distributed and not stacked. PART 2 PRODUCTS NOT USED PART 3 EXECUTION 3.01 PRE-JOB DAMAGE SURVEY A. Contractor shall perform a pre-job damage survey of the existing rooftop and site components including roof, building exteriors, walkways, pavers, pavements, site features, landscaping, grass, and building interior finishes to document existing damaged conditions prior to beginning work. It is recommended that the Contractor coordinate with the Owner’s representative to have the current working condition of any equipment associated with the roofing system as a part of the Pre-Damage Survey. B. Contractor shall submit required documentation, including either videotape footage of the survey and/or photographs and sketches, as necessary to adequately describe existing conditions and to allow for the location of noted defects. If no time stamp is provided on documents, it is critical that the Contractor submit the Pre-Job Damage Survey to the Engineer prior to the start of work. Video of the existing conditions is acceptable as long as the footage is narrated to describe conditions observed and footage is taken at the proper distance and focus to make described conditions visible. C. It shall not be the responsibility of the Owner and/or Engineer to review or approve the contents of the Contractor’s Pre-Job Damage Survey. The contractor may request that the Engineer or Owner accompany them to observe a specific condition if there are questions or adequate documentation by video or photographs may not be feasible. D. The Contractor shall be responsible for repair or replacement of materials that are damaged during construction activities and were not documented within the Pre-Job Damage Survey to have been damaged prior to beginning the work. Items/materials that are damaged shall be returned to the condition they were in prior to construction activities. If return to pre-construction condition is not possible/practical, Contractor shall replace item/material with new to the satisfaction of the Engineer and Owner. 3.02 DEMOLITION A. Water test underground drain lines (as applicable) in conjunction with the Pre-Job Damage Survey. The purpose of the test is to confirm that water flows freely from the downspouts into the drain lines without evidence of clogging, or backup prior to the start of demolition work. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 024110.4 – SELECTIVE DEMOLITION Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 B. Notify the Engineer and Owner of suspected or observed damage/clogging of drainage leaders not already identified. C. Demolish indicated areas in an orderly and careful manner. Protect existing structural members. D. Inspect existing roof deck where exposed. Notify Owner/Owner’s representative of areas of deteriorated or damaged deck. E. The Owner’s representative or Designer and Contractor shall document the actual quantity of any estimated quantity allowance work used. If the Owner’s representative or Designer is not available, a photograph of the material to be replaced must be taken and the material set aside for observation. The Contractor shall not be reimbursed for any material not verified properly. F. Deck or substrate confirmed to be damaged shall be replaced or repaired prior to installing new roof system. Replace damaged deck or substrate with new material of profile, size and type to match existing as closely as possible. G. Do not remove more existing roof system materials than can be replaced with new materials to a watertight condition by the end of the same workday. Contractor shall have ready necessary temporary protection from weather at all areas of demolition to protect interior of building from elements in the event of unexpected inclement weather. H. Cease operations and notify the Owner immediately if adjacent buildings, finishes, or structures appear to be endangered. Do not resume operations until corrective measures have been taken. I. Clean all dust and debris from the exposed substrate. Debris will not be allowed to accumulate on the roof surface and must be removed from the roof daily. Material and debris shall be transported to and from the roof by crane, hoist, or forklift unless otherwise approved by the Engineer or Owner. If crane is used, it shall be operated by a certified crane operator. J. Provide wind screens or other protection as necessary to prevent windblown debris from the roof surface or from dumpsters. K. Drag a magnet on the ground daily to remove the fasteners and metal pieces. Dispose of all debris daily. L. Debris must be removed from the site daily unless enclosed by a dumpster, trailer, or other sided container that can be covered if necessary to prevent blowing debris. Do not stockpile materials on the site unless agreed upon with the Owner’s representative. Do not burn or bury materials on site. M. Contractor shall have all potential repair materials on site prior to start of demolition to avoid delay in repairs. N. Estimated quantities of work are included in the Base Bid per Section 012100 for existing components that may require repair/replacement. At project completion, or completion of particular project milestones, the actual quantities work performed will be compared with the estimated quantities to determine if changes to the contract sum (addition or deduct) may be DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 024110.5 – SELECTIVE DEMOLITION Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 required. To ensure that accurate quantities of work performed are included in this comparison, the Contractor must provide specific documentation of work type, quantities, and confirmation that work was warranted. Documentation can include review of existing conditions or work performed (prior to covering) by the Contractor and Engineer (or Owner’s representative) with agreed upon quantities photographed and documented in the Engineer’s site visit report. If the Engineer is not available, the Contractor is responsible for photographing the damaged/deteriorated materials/conditions and photographing the repaired/replaced materials (with scale to allow for confirmation of measurements) of the material and submitting these to the Engineer at the next site visit or progress meeting. If approved by the Engineer, it may be acceptable to stockpile removed deterioration component/material (when applicable) until confirmation by the Engineer can be made. Payment for work performed (or consideration of work performed toward the estimated quantities) may not be provided without proper documentation. O. Raise all penetrations as needed to finish a minimum of 8" above the finished roof surface. P. Do not burn or bury materials on site. END OF SECTION 024110 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 061000.1 – ROUGH CARPENTRY Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 061000 ROUGH CARPENTRY PART 1 GENERAL 1.01 WORK INCLUDED A. Provide labor, materials, equipment and supervision necessary to complete the following work: 1. Install new perimeter wood blocking where shown on the design drawings or otherwise required for proper installation of the work. Replace existing wood blocking that is intended for reuse within the new roof system but is discovered to be missing, deteriorated, or damaged. Estimated quantities for material replacement are included in Section 012100. 2. Replace existing oriented strand board that is intended for reuse but is discovered to be deteriorated or damaged. Estimated quantities for material replacement are included in Section 012100. 1.02 QUALITY ASSURANCE A. Contractor shall provide sufficient qualified workmen and supervisors who shall be present at all times during execution of this portion of the work and who shall be familiar with the type of construction involved and the materials and techniques specified. B. The Owner shall make no allowance for lack of skill of the workmen. 1.03 SUBMITTALS A. Submit product data and SDS for each product listed in this specification section and others required by the roof membrane manufacturer for a complete installation of the work. B. Submit product data for each fastener type to be used in the securement of the blocking to wood roof deck, steel, masonry, or other blocking, along with a physical sample of each fastener type (if requested). Clearly mark product data sheets to confirm fastener type, length, and location of intended use. The Contractor may re-submit additional fastener types and data if any change to the fasteners to be used occurs. 1.04 DELIVERY, STORAGE, AND HANDLING A. Deliver roofing materials, insulation, and accessories in manufacturer’s original protective containers with labels intact and legible. Comply with manufacturer’s published instructions for storage and handling. B. Store materials in dry protected areas, on clean, raised platforms with securely anchored weather protective coverings in accordance with Section 016000. C. Store flammable products away from sparks or open flames. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 061000.2 – ROUGH CARPENTRY Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. Maintain temperature and humidity ranges required by the manufacturer for each product. PART 2 PRODUCTS 2.01 MATERIALS A. Wood Blocking (Treated): Shall be No. 2 or better southern yellow pine, kiln-dried prior to and to a moisture content of not more than 19 percent. Shall be sound, thoroughly seasoned, dressed to nominal finish dimension, and free of warpage, cupping, and bowing. All nailers and other blocking associated with the roofing installation shall be pressure treated with 0.40 pcf retention of alkaline copper quaternary (ACQ) and shall conform to AWPA Standard U1, to the requirements of use category for ground contact. Asphaltic or creosote preservatives shall not be used. The presence of AWPA mark confirming preservative type and retention (use category) on each piece is required. Where full penetration of ACQ is not evident, field cuts shall be coated in accordance with AWPA standard U1. Dimensions shall be determined by job conditions. Site-sawn ends shall be treated with one coat of preservative treatment. B. Oriented Strand Board Decking: Shall be stamped APA-rated minimum 24/16 span rating, Exposure 1. For oriented strand board installed to repair/replace existing materials, match the existing oriented strand board thickness (field verify) exactly to maintain a flush surface with surrounding materials. Secure OSB through insulation and into cementitious wood fiber deck below with nylon fasteners specially sized and threaded for securement of insulation/decking to cementitious wood fiber plank. C. Cementitious Wood Fiber Plank Deck: Shall be a composite of 7/16" OSB, 2.5" rigid insulation, and 2" structural cementitious wood fiber deck. Deck shall meet minimum standards as Tectum E Panel as manufactured by Armstrong Building Solutions. The deck must extend 3 spans. Fastening and fastening pattern is to be provided by the manufacturer. Size to match existing. 2.02 ACCESSORIES A. Fasteners specified shall be the minimum required product. If a condition exists that does not match a fastener condition or type listed below, the Contractor may submit a separate type and profile of fastener for review. All fasteners to be used to secure treated wood products must be a stainless steel. B. Wood to masonry/concrete: Minimum 1/4″ diameter stainless steel masonry/concrete anchors. Where additional wood blocking, roof membrane, or sheetmetal flashing will cover the secured wood component, anchor heads must be either countersunk or otherwise finish flush with the surface of the wood. Minimum embedment into the substrate shall be 2″, unless otherwise required by the manufacturer to meet required pull-out resistance. Pre-drill for fasteners as required/recommended by the manufacturer, or necessary to prevent spalling of the substrate material. Plastic or nylon anchors shall not be allowed. Fastener spacing shall not exceed 12″ on center unless otherwise noted on the drawings. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 061000.3 – ROUGH CARPENTRY Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 C. Wood to steel angles: Minimum self-tapping, 410 stainless steel 1/4″ no. 14 screws and a minimum of 2.5″ long. Use a flat head screw. D. Wood to metal (general): Minimum self-tapping, stainless steel no. 12 screws. Where additional wood blocking, roof membrane, or sheetmetal flashing will cover the wood component, anchor heads must be either countersunk or otherwise finish flush with the surface of the wood. Minimum fastener penetration shall be 1″, unless otherwise required by the manufacturer to meet required pull-out resistance. E. Wood to wood: Minimum No. 10 stainless steel wood screws. Where additional wood blocking, roof membrane, or sheetmetal flashing will cover the wood component, fastener heads must be either countersunk or otherwise finish flush with the surface of the wood. Minimum fastener penetration into the wood blocking substrate below shall be 1-1/4″. F. Fastener spacing is generally indicated on the design details, but if fasteners are not specifically shown or spacing not noted, provide a maximum 12″ on center staggered for wood blocking with 2 fasteners at each end or 1 fastener for each 2 square feet for plywood, unless otherwise required by the roof system manufacturer. PART 3 EXECUTION 3.01 INSPECTION A. Verify that existing construction is sound and dry so as to adequately support new roofing components. B. Verify that curbs are sound, firmly anchored, smooth, and clean on surfaces scheduled to receive new nailers. C. Verify that surfaces of masonry walls are level, sound, firmly anchored, and smooth. D. The Owner’s representative and the Contractor shall document the actual quantities of materials installed when existing deteriorated materials must be replaced. 3.02 INSTALLATION – NAILERS AND BLOCKING A. Verify that existing construction is sound and dry so as to adequately support new components. B. Install wood perimeter blocking where shown on the drawings or indicated in the specifications. Cut blocking to size where shown on the drawings or required for proper installation of the work. C. Install new wood blocking at other locations as shown on the drawings or required by the roof system manufacturer for proper installation of the details. D. Fasten existing wood nailers, blocking, etc., at spacings to comply with new membrane manufacturer’s latest written instructions or the fastening requirements provided in this specification section, whichever is more stringent. Wood blocking and nailers shall be securely anchored to the DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 061000.4 – ROUGH CARPENTRY Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 roof deck to resist a minimum uplift force of 300 pounds per linear foot, but no more than 12" o.c. apart unless a more stringent spacing is required to meet FM Loss Prevention Data Sheet 1-49. If fastener pull-out values performed by the Contractor prior to start of work indicate that specified fastening patterns will not meet this requirement, increase the number of fasteners as necessary to meet requirement. E. Fasteners shall be positioned 6" from each end and a maximum of 12″ on center and staggered 1/3 the nailer width. Two fasteners shall be installed at ends of nailer lengths. Wood nailer pieces shall be no less than 12″ in length and shall be secured with a minimum of two fasteners per piece. F. All nailers shall finish flush with the insulation. G. Install new wood materials true to line, level, plumb, and securely fastened to the approved substrate with fastener type and fastening requirements as specified. H. New wood nailers shall have a 1/4" gap between each length. I. Where new or raised wood curbs are to be installed, corners shall be formed by lapping side members alternately. 3.03 OSB REPLACEMENT A. Remove damaged/deteriorated portion of OSB when it has delaminated from the insulation beneath. B. Cut new OSB to fit size of removed section. Allow for a minimum 1/8" gap between the boards for movement. Joints of new OSB board should be installed with 1/8” gaps. C. Secure the OSB to the cementitious wood fiber deck through the insulation with fasteners @ 12” o.c. along the perimeters and no more than 24” o.c. in the field of the OSB board. 3.04 CEMENTITIOUS WOOD FIBER COMPOSITE DECK REPLACEMENT A. At locations where the existing composite roof deck is damaged full depth or the cementitious wood fiber portion of the deck is damaged, remove the damaged/deteriorated portion of the plank deck down to the steel structure. Unless otherwise recommended by the manufacturer, the new deck should extend over a minimum of three spans. B. Install construction adhesive along the top of the joist and panel edges in accordance with the manufacturer’s requirements/recommendations. C. Install new composite deck into opening. D. Secure deck to the steel joist in accordance with the manufacturer’s requirement. Minimum of 4 screws per bearing. END OF SECTION 061000 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.1 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 073113 ASPHALT SHINGLED ROOF SYSTEM PART 1 GENERAL 1.01 WORK INCLUDED A. Inspect the composite roof deck, wood blocking, and other components to remain and repair or replace damaged or deteriorated materials in accordance with this section and Section 061000 of these specifications. B. Base Bid: Install nailbase insulation mechanically fastened to the existing OSB. C. Alternate Bid 01: Install vented nailbase insulation mechanically fastened to the existing OSB in lieu of the standard nailbase. D. Install one layer of self-adhered underlayment at the eaves, ridges, rakes, and high eave. Install synthetic underlayment on remainder of roof. E. Install new laminated, dimensional asphalt shingles in accordance with applicable sections of the specifications. The new shingled roof system must meet the requirements for UL Class A fire classifications and wind uplift resistance in accordance with these specifications, the North Carolina State Building Code and ASCE-7, latest edition. F. Install new sheetmetal flashings, trim, wall panels, and other associated transition flashings and accessories in accordance with Section 076200. G. Install other accessory items such as fasteners, sealants, tape sealants, mastics, and ridge vent components, as necessary to provide a complete and watertight installation in accordance with the specifications, design drawings, and the warranting manufacturer’s installation instructions. 1.02 QUALITY ASSURANCE A. Contractor shall have a minimum of five years of experience in the installation of asphalt shingle roof systems and accessories. Contractor must have the necessary certifications from the approved shingle manufacturers to install and provide the specified warranty coverages. B. Use adequate number of skilled workmen who are trained and experienced in the necessary crafts and who are familiar with the specified requirements and the methods needed for performance of the Work. C. When specified in respective Specification Sections or required to obtain specified system warranties, require manufacturer to provide qualified personnel to observe field conditions, conditions of surfaces and installation, quality of workmanship, as applicable, and to make appropriate recommendations. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.2 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. Maintain one copy of this project manual, the design drawings, and the manufacturer's application instructions on project site. 1.03 SUBMITTALS A. Submit written confirmation of contractor’s approved applicator’s status from the asphalt shingle roof system manufacturer. B. Submit color charts for shingles and associated samples of asphalt shingles in either the color selected by the Owner or as a variety to show available color selections. Provide a 6" x 6" sample of underlayment and samples of other accessories (as requested), with manufacturer’s identification labels attached. C. Submit product data for each product listed in this specification section and others required by the asphalt shingle roof system manufacturer for a complete installation of the work. Submit applicable SDS sheets for products to be used during installation. D. Submit asphalt shingle manufacturer’s application manuals, which describe completely the preparation of surfaces and application of specified materials. E. Submit shop drawings showing detail, fabrication, and fastening devices for each condition encountered. Shop drawings must be signed as approved by the shingle manufacturer when they vary from the manufacturer’s standard details. F. Submit a sample copy of the asphalt shingle roof system manufacturer’s warranties. Although the warranties may be sample copies they should bear the project name and have any warranty lengths marked on them or in an accompanying letter from the manufacturer to confirm they meet the specified requirements. G. Certificate of Compliance: Provide Certificate of Compliance from an independent laboratory indicating that the asphalt fiber glass shingles made in normal production meet or exceed the requirements of the following: 1. ASTM E 108/UL 790 Class A Fire Resistance. 2. ASTM D 3161/UL 997 Wind Resistance for 110 mph wind speed (Class F) 3. ASTM D 3462: Standard Specification for Asphalt Shingles Made from Glass Felt and Surfaced with Mineral Granules. 1.04 DELIVERY, STORAGE, AND HANDLING A. Deliver roofing materials and accessories in manufacturer’s original protective containers with labels intact and legible. Comply with manufacturer’s published instructions for storage and handling. B. Store materials in dry protected areas, on clean, raised platforms with securely anchored weather protective coverings. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.3 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 C. Store flammable products away from sparks or open flames. D. Store roofing materials at a minimum of forty-five (45) degrees Fahrenheit prior to use as recommended by the roof membrane system manufacturer. Protect material from freezing. 1.05 ENVIRONMENTAL REQUIREMENTS A. Proceed with roofing work only when weather conditions comply with roof system manufacturer’s recommendations. Do not violate temperature limitations recommended by the manufacturer. B. Take special care if applying self-adhering waterproof underlayment when ambient or wind chill temperature is below 45° F (7 °C). Fasten/tack the underlayment in place if immediate adhesion to the deck does not occur. 1.06 WARRANTIES A. Provide a Contractor’s 5-year Warranty for all work included in the project. This warranty shall include workmanship, materials of the roofing systems against leakage and against defects due to faulty materials, workmanship and contract negligence following acceptance of the project by the Owner, and will be provided in addition to the roof system manufacturer’s warranties. The warranty will extend for a period of sixty (60) months from the date of Final Completion unless otherwise agreed upon by the Owner and Designer. B. Provide Roof System Manufacturer’s 40-year limited system warranty covering labor and materials for replacement or repair for manufacturing defects in the shingles. The warranty shall also include a clause for a 10-year algae resistance warranty or a separate algae resistance warranty may be provided. The warranty shall also include a clause for a 10-year wind warranty for the rated wind speed (110 mph). The warranty will begin from the date of Final Completion unless otherwise agreed upon by the Owner and Designer. C. Provide an extended roof system manufacturer’s warranty covering material and labor costs for repairs or replacement, disposal costs, and workmanship defects for a minimum period of 5 years from the date of Final Completion unless otherwise agreed upon by the Owner and Designer. This warranty shall be provided in addition to the roof system manufacturer’s limited warranty and shall not be subrogated to the installing contractor. D. Provide other standard available manufacturer’s material warranties as applicable. 1.07 EXTRA MATERIALS A. Provide adequate shingle “attic” stock to the Owner to allow for isolated repairs totaling 200 square feet of the type specified. Provide a representative color variation to best match the variation in the shingle color utilized on the project. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.4 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 PART 2 PRODUCTS 2.01 NAILBASE AND UNDERLAYMENT A. Nailbase Insulation (Base Bid): Shall be comprised of 1” thick polyisocyanurate bonded to 19/32” CDX plywood. Basis of design is Atlas ACFoam Nail Base. B. Nailable Vented Roof Insulation (Alternate Bid 01): Shall be a cross ventilated, non-structural composite insulation consisting of 1" thick polyisocyanurate insulation with a 19/32” thick exterior grade plywood separated by and bonded to individual 1" thick wood or insulation spacers to form a vented space. Manufactured in accordance with ASTM C1289, Type V. The polyisocyanurate shall have a compressive strength of 20 psi per ASTM D1621. Use mechanical fasteners of a type and length specifically recommended for the product installation in the specified assembly by the manufacturer of the nailbase. Fasteners must be long enough to secure nailbase through insulation and into the existing OSB. Basis of design is ACFoam CrossVent manufactured by Atlas, Cool-Vent manufactured by Hunter, or approved equal. C. Self-adhering Waterproof Underlayment (At perimeters, penetrations, and transitions): Sheet barrier of self-adhering rubberized asphalt membrane underlayment with internal reinforcement meeting ASTM D1970. Material shall be compatible with the shingles to be installed and approved by the shingle manufacturer for use as a part of the warranted system. Materials to be installed behind sheet metal flashings at perimeters shall be capable of withstanding anticipated high temperatures without damage, deterioration, bleed, or binding. D. Underlayment (Cover remaining roof area): Shall be a synthetic, high-strength polypropylene, UV stabilized, slip resistant, resist wrinkling/buckling underlayment and must be provided by the shingle manufacturer providing the warranty. 2.02 SHINGLES A. Glass fiber mat base with ceramic colored/UV resistant, mineral surface granules across entire face of shingle. Shingles shall be algae-resistant; minimum two-layer laminated architectural/dimensional shingle with a minimum dimension of 12” x 36”, for installation with a minimum 5″ exposure. B. Shingles shall meet the following requirements: UL Certification of ASTM D3462; ASTM D3018 Type I - Self-Sealing; ASTM D3161-03b, Class “F” Wind Resistance (110-mph); UL997 Wind Resistance, and UL Class A Fire Resistance. 1. Acceptable manufacturer of shingles include: a. GAF – Timberline HDZ b. Owens Corning - Duration c. Certainteed – Landmark d. Other equivalent manufacturer’s (approval prior to bid required) DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.5 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 Note: The listed manufacturers are provided as examples of manufacturers and products that typically meet the requirements of these specifications. The listed manufacturers are acceptable only if they are able to meet the requirements of the specifications and listed warranty requirements. The cited examples are used to denote the quality standard of product desired. Requests for substitution of another manufacturer or product must be submitted in writing to the Engineer for approval or disapproval no less than 10 days prior to the bid date. Submitted requests must include sufficient documentation to indicate that manufacturer and/or product submitted meet the requirements of these specifications and are equivalent to the quality of those listed. Requests for substitutions must be submitted by qualified project bidders and will not be accepted from manufacturers. C. The Owner will select the shingle color from the manufacturer’s available standard colors upon submittal of the color options by the roofing contractor. Manufacturer’s must have a minimum of 8 standard colors. 2.03 FASTENERS A. Shingle Fasteners: Standard rough shank type roofing nails, corrosion resistant; hot dipped zinc coated steel, aluminum, or stainless steel; minimum 3/8″ (9.5 mm) head diameter; minimum 11 or 12 gage (2.5 mm) shank diameter; shank to be of sufficient length to penetrate through roof sheathing or 3/4″ into solid wood, plywood, or wood decking. B. Nailbase Fasteners: Shall be a heavy duty, nailable insulation fastener with #4 heavy duty drill point and supplied by the nailable roof insulation manufacturer. Fasteners must be of adequate length to properly penetrate the existing OSB dependent on the use of non-vented or vented nailbase. C. Cap Nails for Underlayment: Shall be provided by the shingle manufacturer. 2.04 ACCESSORIES A. Asphalt Roofing Cement: ASTM D 4586, Type I or II B. Specialty Shingles: Provide special ridge, hip, and starter shingles specifically designed for installation at these detail locations. Cut existing shingles for installation at hip and ridge locations only if specifically recommended by the manufacturer for provision of warranty. C. Ridge Vent: Provide a pre-fabricated, “shingle-over” ridge vent with external baffles to prevent rain and snow infiltration. The width of the ridge vent must match the width of the ridge shingles and must provide a minimum net free ventilating area of 16 square inches per linear foot. Material shall be compatible with the shingles to be installed and approved by the shingle manufacturer for use with their warranted system. D. Sealants: For sealants required at any locations not specifically provided or recommended by the roof system manufacturer, use, one-part, low modulus non-sag polyurethane-based sealant in accordance with ASTM C920, Type S, Grade NS, Class 25. If sealant is to be used in a high temperature application (i.e. at chimney flue), confirm that acceptable temperature range of sealant DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.6 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 will not be exceeded. Clear sealant will not be accepted. Color shall be approved by the Engineer. Acceptable manufacturers/products include, but are not limited to: Sika Corp., Sonneborn Building Products, and Tremco, Inc. E. Lead Penetration Flashings (Vent Pipes): Provide lead penetration flashings, minimum 4 lb. where shown on drawings. Lead flashing must consist of a vertical sleeve soldered to a flange of adequate size to allow for installation as shown on the drawings and allow for a 3” overlap over the exposed slate at the downslope side and a 6” overlap beneath the last slate on the upslope side. Provide a separate formed lead cap with watertight soldered seams. F. Gas Vent Flashing: Shall be stainless steel pre-fabricated flashing specifically for gas pipes. A rain collar is to be installed over the top of the flashing. G. Sealant for Gas Vent: Shall be silicone based sealant similar to Pecora 864NST H. Provide asphalt shingle roof system sealants/mastics as required by the roof system manufacturer or as shown on the drawings for proper installation of system components. PART 3 EXECUTION 3.01 INSPECTION AND SURFACE PREPARATION A. Define the area of roof to be removed in order to ensure that the entire area can be covered with the new underlayment and made watertight during the same work day. B. Plan the proper sequence of work between removal of existing roof components, installation of new adjacent roof systems and transition flashings, and the installation of the underlayment and asphalt shingled roof system to ensure details will be installed properly with the minimum of construction traffic over the new roof system components. C. Remove the existing shingled roof system, flashings and other items necessary for installation of new roof system and dispose of off-site in accordance with Section 024110 of these specifications. D. Inspect and repair/replace existing composite roofdeck as required by Sections 024110 and 061000. Application of materials shall constitute acceptance of the surface by the contractor. Should the Contractor find the substrate unacceptable and outside the preparation requirements contracted for, the Owner’s representative shall be immediately notified in writing to allow appropriate actions to be taken. 3.02 NAILBASE (BASE BID) AND VENTED NAILBASE (ALTERNATE BID 01) INSTALLATION A. Install nailbase insulation (non-vented for Base Bid and vented for Alternate Bid 01) over the existing OSB at a minimum rate of 15 fasteners per 4’x8’ board in the field and 20 fasteners per 4’x8’ board at the perimeter, and 25 fasteners per 4’x8’ board at the corners. Use manufacturer’s required fastener layout. Fasteners must be long enough for a minimum of 1” penetration through the existing OSB. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.7 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3.03 UNDERLAYMENT INSTALLATION A. Install one layer of self-adhering underlayment perpendicular to slope of roof at the eaves(parallel to the eaves), and lap a minimum of 6" at end laps. The underlayment should extend a minimum of 30" onto the roof surface. Also install self-adhered underlayment along rake edges, ridges, penetrations, and transitions where indicated on the detail drawings. Turn down perimeter and underlayment to cover exterior face of wood blocking. Press down all laps with a roller to assure immediate adhesion. Install one layer along ridge and roof penetrations, in accordance with the drawings. B. Install synthetic underlayment over the remainder of the roof overlapping the self-adhered underlayment a minimum of 6". Underlayment should be installed flush over the roof deck without wrinkles, gaps, or buckles. Although it is preferred that only roof that can be shingled in a day is removed, in the event that the underlayment is exposed overnight, moisture from dew should be allowed to completely dry before shingle installation. C. Cracked, wrinkled, torn, or otherwise damaged underlayment (both self-adhering and synthetic) will not be accepted and will require removal and replacement. In no event will underlayment be allowed to remain exposed to UV for more than 21 days. Prior to roofing over the underlayment, inspect for damage and replace or recover any worn or torn areas. D. Take special care if applying self-adhering waterproof underlayment when ambient or wind chill temperature is below 45 °F (7 °C). Fasten/tack the underlayment in place and seal laps with a heat gun or a polymer-modified cement if immediate adhesion to the deck does not occur. If fastened, use hand-driven roofing nails, staples and pneumatic nailing will not be accepted. 3.04 SHINGLE INSTALLATION A. Measure and chalk vertical and horizontal lines to layout the shingle installation and maintain even spacings and consistent exposures. Watch for irregularities in the existing roof deck that may require repair or replacement of deck prior to shingle installation to prevent irregularity from showing through the shingled system. B. Install shingles in accordance with manufacturer's instructions for product type and application specified and the detail drawings. C. Fasten each full and trimmed shingle with a minimum of 6 nails at proper locations on shingle at locations recommended by the manufacturer. Fasteners must be hand-driven straight, with nail heads flush with the shingle surface and never cutting into the shingle. Use of staples and pneumatic nailers are not accepted. D. Begin shingle installation with the manufacturer recommended starter course at the eave. The starter strip should overhang the eave a minimum of 1/2" where a drip edge is not provided. E. Install following full course to fully cover the starter course. Properly stagger and align the succeeding shingle courses working up the roof from the eave as recommended by the DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.8 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 manufacturer to obtain proper coverage, and color variation. Snap chalk lines as necessary to ensure straight and even placement. Maintain the shingle exposure recommended by the manufacturer for the specific shingle selected. Racking of shingles is not accepted regardless of acceptance by the manufacturer. F. Ridges and Hips:At ridges , install shingles up to the ridge deck opening (cut plywood at nailbase to allow for ventilation as shown on the details – Alternate Bid 01). Allow for adequate coverage by making sure that the last course of shingles will not be exposed more than 5" when the hip or ridge cap shingles are applied. 1. At the ridge, install ridge vent material in accordance with the manufacturer’s installation instructions. 2. At ridge and hip, install shingles specifically intended for capping ridge and hip. 3. Install cap starting from the bottom of a hip and one end of the ridge. 4. Bend the cap along the centerline of the longer dimension to form it in place over the hip. Fasten each cap with 2 fasteners a minimum of 1" in from each side edge and at a location from the end of the cap as recommended by the manufacturer to ensure 5"exposure and full coverage of the fasteners with installation of next cap shingle. 5. Be sure that fasteners used are of sufficient length to penetrate through the shingle, the ridge vent (at ridge only), and provide proper penetration into the roof deck as specified. 6. Install succeeding courses of cap shingles working up the hip or along the ridge. If the manufacturer allows face-nailing the last cap in a row of hip or ridge, protect the nail heads with a spot of asphalt roofing cement and an aesthetic cap shingle set in asphalt cement. 7. Install the pre-fabricated ridge ventilation system with filters, support material, and baffles in accordance with the ridge ventilation system manufacturer and shingle manufacturer’s installation instructions. The direction of lap for the ridge cap shingles should be kept consistent along each ridgeline and should be determined prior to the start of installation. 8. The cutting of the deck for the ventilated ridge detail should be held back 6” from the gable ends and should stop 12”-18” back from ridge-to-valley intersection in each direction to allow for proper termination of the pre-fabricated vent material and securement of the tops of the valley flashings. G. Use starter course along rake edge. H. Follow manufacturer’s requirements for perimeter sealing of shingles if necessary to meet wind uplift resistance requirements. I. To prevent visible areas of variation in shingle color or texture premix the bundles before loading the roof to provide even distribution of bundles. After initial installation begins, inspect the roof from the ground at a distance of no greater than 40 feet to confirm that consistent appearance has been obtained. This process should be repeated throughout installation at regular intervals. Failure to mix bundles resulting in uneven areas of coloration may result in rejection of the installation. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.9 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3.05 FLASHING A. For sloping roofs which abut vertical surfaces, provide stepped metal flashing as per the recommendations of the National Roofing Contractors Association (NRCA). Install step flashing in accordance with Section 076200, Sheet Metal Flashing and Trim. Form step flashing with a 2" head lap and a minimum extension of 4" over the underlying asphalt shingle and up the vertical surface. B. Provide edge metal and trim at all gables, rakes, and eaves. Secure metal to substrate with fasteners at 12" o.c. unless otherwise noted on the design drawings or required by the manufacturer. C. Place rake metal tight with fascia board. Lap joints 2" and seal with flashing cement. D. The top shingle to be covered by metal shall have a 3" head lap. 3.06 FIELD QUALITY CONTROL A. Correct defects and irregularities as directed by Engineer or Owner’s representative. B. Suspend application and installation activities during inclement weather. C. Require technical representative of roof system manufacturer to make inspections as necessary to qualify roofing system for manufacturer’s warranty specified in this section (minimum of 2 visits). D. Inform Engineer of all manufacturer’s inspections a minimum of 48 hours before inspection is to take place. Provide a copy of manufacturer’s inspection reports to the Engineer. 3.07 PROTECTION OF FINISHED WORK A. Restrict construction traffic and equipment movement on the completed roof to essential personnel. Provide appropriate protection against traffic and construction activities on completed roofs. B. Coordinate the proper order of associated work including, but not limited to adjacent single-ply thermoplastic roof system installation, flashing installation, replacement of gutter lining, EIFS repair and other miscellaneous installations to avoid damage to the new roof system. 3.08 TEMPORARY WATER CUT OFFS AND WATERTIGHNESS DURING CONSTRUCTION A. Install a temporary watertight seal between the section of the new roof completed and the adjacent existing roof system at the end of each work day. The new roof system shall be sealed so that water will not be allowed to travel under the new or existing roof system. When work resumes, contaminated materials from the water cut off including membrane and insulation shall DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 073113.10 – ASPHALT SHINGLED ROOF SYSTEM Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 be removed from the work area and disposed of offsite. None of these materials shall remain or be reused in the new system installation. B. Discovery of water entry into the building during inclement weather must be immediately followed by action by the Contractor or representative to prevent or limit damage or effect on interior finishes and materials. Immediate preventative actions shall be followed promptly by temporary repair activities to reduce or stop water entry into the roof system. If water entry into the roof system occurs, the affected materials shall be removed back to dry/sound materials and replaced with new materials at the Contractor’s expense. C. If water entry into the building occurs, the Contractor must promptly review and agree upon the damages with the Owner’s representative. Repairs to the interior finishes must be completed promptly within a scheduled time frame agreed upon by the Owner. Replacement, repair, or reimbursement for damaged interior materials (equipment, books, furniture, etc.) must be completed promptly within a scheduled time frame agreed upon by the Owner. If the timeline provided by the Contractor is not satisfactory to the Owner, and an agreement cannot be promptly reached, the Owner reserves the right to perform such repairs or replacements and shall deduct the cost of repairs from the Contract Sum. D. The Contractor shall coordinate with the Owner if they would like to provide afterhours protection of interior materials (computers, equipment, finishes) at areas of specific concern or liability. Installation of protection such as plastic sheets, etc. shall be performed by the Contractor’s personnel with the advance acceptance of Construction Management personnel and building occupants. Installations shall not damage permanent materials or finishes. Contractor shall be responsible for removal of the temporary protection for normal use of the interior contents during standard building hours. 3.09 JOB COMPLETION A. Inspect completed roofing and correct defects to meet the specification requirements prior to request for pre-final inspection by the Engineer and Owner. B. Clean up debris, excess materials and equipment, and remove from site. C. Clean drips and spills of roof cements or sealants. END OF SECTION 073113 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.1 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 076200 FLASHING AND SHEET METAL PART 1 GENERAL 1.01 WORK INCLUDED A. Provide all labor, materials, equipment and supervision necessary for fabrication and installation of metal flashings, gutters, downspouts/straps, cleats, counterflashings, wall panels, support framing, trim, and accessories, as specified herein and as required by detail drawings. B. Coordinate work of this section with work of Sections 024110, 061000, and 073113. 1.02 QUALITY ASSURANCE A. Standards: Comply with standards specified in this section as they apply to the provision and installation of components specified herein. B. Qualifications of Manufacturer/Fabricator: 1. Products used in the work included in this section shall be produced by manufacturers regularly engaged in the manufacturer of specified items and with a history of successful production for a minimum of 10 years in the United States. 2. Sheet metal flashings and trim must be fabricated in accordance with the requirements of SMACNA and the NRCA with adequate fabrication equipment to provide required profiles and prevent damage to pre-finish. 3. Shop-fabricated perimeter metal flashing configurations must be tested and meet the requirements of ANSI/SPRI ES-1 C. Qualifications of Installer: 1. The roofing installer must have experience installing sheetmetal on projects of equal to greater size, for a minimum of five (5) years 2. The roof system installer must have adequate number of skilled workmen, thoroughly trained and experience in the necessary craft. Workers performing installation must be led by a job foreman with a minimum of three (3) year’s experience in the type of installation specified whenever work installed will become part of a warranted roof system (including related flashing work). In determination of acceptance or rejection of work, no allowance will be made for lack of skill on the part of the workmen. 3. The roofing foreman must be capable of communicating fluently in English or a full-time translator must be provided and identified by the roofing installer. The translator must be on site at all times that the crew and foreman are present. 4. Attend a Pre-Installation Roofing Conference at the project site prior to the start of roofing installation. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.2 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 1.03 SUBMITTALS A. Provide a complete list of materials proposed for use including product data sheets and SDS for each product including accessory materials (fasteners, sealants, etc.). 1. When multiple products, thicknesses, etc. are shown on a single product data sheet, identify specific components intended for use. 2. For fasteners identify exact fastener type, material, and locations intended for use. 3. Product data provided must be sufficient to confirm that materials meet these specifications. B. Provide color chart(s) for selection of pre-finished metal colors. Provide sample color chips upon request by the Designer. For sheetmetal provided by a manufacturer different from the metal roof system manufacturer, the color must be able to be obtained that matches the color of the roof panels/flashing exactly. The Owner may elect to choose a second pre-finished metal color for isolated flashings (portions of wall panel, downspouts, etc.). C. Provide Shop Drawings indicating material types, gauges, profiles, jointing patterns and details, fasteners and fastening methods, terminations, locations of field-applied sealants, colors, to clearly indicate interaction between sheetmetal flashings and roof components. Shop drawings for sheetmetal components may be incorporated into shop drawings for the standing seam metal and membrane roof systems. D. Provide confirmation that perimeter detailing submitted in the shop drawings meets the requirements of ANSI/SPRI ES-1. E. Provide a sample copy of the manufacturer's standard pre-finish warranty. F. Mock-Ups: The Contractor may be requested to perform in-place mock-up installations of representative gutter, rake, downspout, high eave flashing, and other flashing installations to ensure that detailing is understood and level of workmanship is acceptable prior to the start of full sheetmetal fabrication/installation. If accepted, mock-up installations may remain in place as part of the new installation. 1.04 DELIVERY, STORAGE AND HANDLING A. Deliver sheet metal materials and accessories with original protective wrap or boxing with labels intact and legible. Comply with manufacturer's published instructions for storage and handling to prevent staining, denting, scratches, or other surface damage. B. Store materials in dry protected areas, on clean, raised platforms with securely anchored weather protective coverings and in such manner as to prevent condensation or staining. Stack material to prevent twisting, bending, or abrasion. C. During storage prevent material contact with any substance that would discolor or stain, including soil and water. D. Handle pre-finished sheetmetal and products in a manner to reduce damage and scratching. Pad or tape equipment and breaks and use gloves to minimize fingerprinting. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.3 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 1.05 SCHEDULING A. The Contractor shall field verify existing conditions prior to fabrication of sheetmetal components. Minor dimensional detail changes may be required to fit existing conditions. Field verification must be performed with enough time to make revisions to shop drawings and to allow for proper fabrication of components without project delay. B. Sheet metal work shall be closely coordinated with the installation of new system materials. Proper sequence of work will be critical to proper installation of the sheetmetal flashings and trim. C. Sheet metal installations shall be scheduled such that system terminations will not be left unprotected. 1.06 WARRANTIES A. Provide a Contractor’s Five -Year Warranty for work included in this project in accordance with Section 014000 of these specifications. B. Pre-Finish Warranty: Pre-finished sheet metal shall have a 20-year finish warranty stating that the pre-finish will be free of fading or color change in excess of 5 NBS units in accordance with ASTM D-2244; will not chalk in excess of numerical rating of 7 in accordance with ASTM D 659; and will not peel, crack, chip or delaminate. PART 2 PRODUCTS 2.01 SHEETMETAL MATERIALS A. Pre-Finished Coating: Shall be pre-finished with a two-coat, coil-applied, baked-on fluoropolymer coating system based on Kynar 500 Fluorocarbon coating with a top side total dry film thickness of 1.0 mils (minimum); bottom side shall be coated with a primer/wash with a dry film thickness of 0.25 mil. Finish shall conform to all tests for adhesion, flexibility, fading, chalking, peel resistance and longevity in accordance with ASTM D 659-80 (chalk rating of 8 or less) and ASTM D 2244-79 (5 NBS units or less). Colors for pre-finished metal shall be selected by the Owner Provide color chip samples for review and approval. The Owner may elect to choose more than one sheetmetal color for wall panels, downspouts and trim/flashing dependent upon location. B. Wall Panels: minimum 24 gauge, galvalume panels, 12-inches wide with concealed fasteners and a flush profile capable of being installed with a vertical orientation. Panels with intermediate beads or stiffeners are not acceptable unless specifically requested by the Owner. Provide required light-gauge support framing for the new wall panels where required. Provide fasteners, end and corner trim, and other accessories required for a proper installation of the panels. C. Soffit Panel: minimum 24 gauge, galvalume panels, 12-inches wide with concealed fasteners and a flush profile. Provide the manufacturer’s perforated/vented soffit panels. Soffit panels, J- channel, trim around lights, perimeter trim, etc. shall be pre-finished with a color selected by the Owner from the available standard colors. The soffit color may or may not be selected to match DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.4 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 the color of the roof and wall panels. Provide required light-gauge support framing for the soffit panels where indicated on the drawings or if required to supplement the existing framing. Provide fasteners, trim and other accessories required for a proper installation of the panels. D. Acceptable Manufacturers: 1. Acceptable manufacturers of the specified standing seam metal roof systems (including wall panels, soffit panels, framing system, and trim/flashings) include: a. McElroy Metal b. MBCI c. Architectural Metal Systems d. Metal Roof Systems (MRS) 2. The cited examples are used to denote the quality standard of product desired. Requests for substitutions must be submitted by qualified project bidders and will not be accepted from manufacturers. Submitted requests must include sufficient documentation to indicate that manufacturer and/or product submitted meet the requirements of these specifications and are equivalent to the quality of those listed. The acceptance of any substitutions is at the sole discretion of the Designer. E. Sheet Metal Flashings: Metal roof system flashings including gutters, downspouts, rake and eave trims, ridge flashing, offset cleats, etc. shall be fabricated from the same material as the metal roof panel (cleats one gauge heavier) and shall be pre-finished to match the metal roof panels unless otherwise noted. Refer to Section 076200 - Sheet Metal Roof Flashings for additional information. Flashings shall generally follow the profiles shown on the design drawings but the Contractor may suggest slight modifications as a part of the submittal process. F. Supplemental Supports (angles, channels, hat channel, eave support plates, etc.): Cold-formed steel, minimum 18 gauge, G90 galvanized structural steel shapes, minimum yield strength of 33 ksi, in accordance with ASTM C955. Profiles must match as generally shown in the design details or as required by the manufacturer for proper support of the new roof system panels and flashings. G. Fasteners: Provide fastener size and length that meet the manufacturer’s requirements: 1. All concealed fasteners must have head profiles that are countersunk or flush with the material being fastened. 2. Exposed fasteners may have head profiles as recommended by the manufacturer with aluminum-backed EPDM washers. The fastener heads must be pre-finished to match the flashing being secured. 3. Perform pull-testing to confirm capacity of fasteners to be used to secure new roof system components to existing materials (wood blocking and steel deck). H. Tape Sealant: Non-curing butyl tape sealant, per AAMA 809.2. Minimum 1" wide and 1/8" thick unless otherwise shown on the Project Drawings or required by the roof system manufacturer. I. Gunnable Sealants: For concealed sealants provide non-curing butyl per AAMA 809.2. For exposed sealants provide single component, non-sag polyurethane sealants per ASTM C920. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.5 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 J. Panel Closures: Provide sheetmetal closures/supports along cut edges of panels. K. Cleats: Continuous cleats, offset cleats: Cleat materials shall match the type of the flashing material that will be attached to them and shall be one gauge heavier than the material they are securing unless otherwise noted herein or on the design details. Where cleats may be visible, match the pre-finished color of the metal they are securing. L. Support Plates/Angles/Closures: Minimum 20 gauge G90 galvanized steel unless otherwise noted in the design details. Angles provided as part of the parapet wall assembly shall be as specified in the structural steel sections of this Project Manual. 2.02 FASTENERS AND ACCESSORY MATERIALS A. Fasteners: Shall be type and size as required by construction. Specific fastener types and sizes should be noted on roofing shop drawings for approval by the Designer. When fasteners will be covered by membrane flashings or sheet metal, head profiles should be selected to minimize pressure on the backside of covering materials or fasteners should be countersunk slightly. B. For metal to metal fasteners, use self-tapping, self-drilling, no. 12 stainless steel sheet metal screws. When exposed use fasteners with integral EPDM washers. i. For concealed fastening into wood, use No. 10, stainless steel, self-drilling wood screws. Minimum embedment shall be 1-1/2”. ii. For exposed fastening into wood, use stainless steel self-drilling screws with integral EPDM washers. iii. For fastening into concrete, use ¼” diameter, masonry/concrete anchors with neoprene washers. Use all metal stainless steel anchors only, no plastic or nylon anchors allowed. Minimum embedment shall be 1”. Do not use drive pins without advance approval, provide pre-drilled fasteners to prevent damage/spalling to the substrate. C. Pop Rivets: Shall be 1/8 inch to 3/16 inch diameter with stainless steel mandrels and washers, color to match pre-finished metal. D. Tape Sealant: Shall be a 7/8" x 3/16" butyl tape sealant with a double bead. Tape sealant shall be non-curing, non-skinning, non-staining, non-corrosive, non-shrinking, non-oxidizing, non-toxic and non-volatile. Composition shall be 99% minimum solids with a butyl base meeting performance standards in Federal Specification TT-C-1796A; Type II, Class B. Service temperature shall be -60 degrees F to +212 degrees F. Tape sealant will not be used at exposed locations. E. Gunnable Sealant: Elastomeric sealant shall be low modulus, non-staining, non-sag, one-part urethane-based sealant of gun-grade consistency. Sealant shall be easily workable and shall be capable of producing a smooth attractive finish. For joints in vertical surfaces, provide ASTM C 920, Type S or M, Grade NS, Class 25, Use NT. For joints in horizontal surfaces, provide ASTM C 920, Type S or M, Grade P, Class 25, Use T. Sealant shall be Dynatrol I, by Pecora Corporation; Sikaflex 15LM, by Sika Corporation, or approved equal. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.6 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 F. Clamps: Shall be stainless steel pipe band clamps with a minimum ¼” width. G. Termination bar: Use only membrane manufacturer-supplied aluminum or stainless steel termination accessories, 1/8” x 1”. Bar shall have pre-drilled slotted holes at 8” o.c. No plastic or polymer termination bars will be accepted. H. Concrete Splashblocks/Pavers: Provide min. 30 lb concrete splashblocks on walktread where roof downspouts discharge at grade onto paved areas/service yards. Where downspouts discharge onto grass/dirt areas, provide concrete “grid/waffle-style” pavers to form a min. 4’x2’ area beneath the downspout. I. Sheathing and Rigid Insulation: Replace damaged exterior sheathing with DensDeck Prime, thickness to match the existing sheathing being replaced. Sheathing must be removed and replaced from one framing member to another to allow for proper securement. Secure sheathing to framing members @ 8” o.c. Removed areas of EIFS must be replaced with polyisocyanurate insulation board with foil-facing per ASTM C1289; thickness to match the existing EIFS (Basis of Design Johns Manville AP Foil-Faced Polyisocyanurate Continuous Insulation). J. Provide pre-fabricated gutter guard that is compatible with the designed gutter profile and securement. Gutter guard must be formed from aluminum and/or stainless steel and should secure to the gutter. Guard must be removable to allow for gutter cleaning. Gutter guard must be acceptable to the Owner and Designer and should not void the shingled roof warranty. K. Other Accessories: Provide other components not specifically listed herein but required for complete and proper installation of the sheetmetal flashings. 2.03 FABRICATION A. In addition to complying with all pertinent codes and regulations, comply with pertinent recommendations as noted in "Architectural Sheet Metal Manual", as published by the Sheet Metal and Air Conditioning Contractors National Association, Inc. (SMACNA). When recommendations conflict with the requirements of the specifications, follow the more stringent requirement or contact the Designer to request clarification. B. Fabricate and install sheet metal sections in 10-foot lengths except where shorter lengths are required by construction. C. Form sections square, true, and accurate to size, free from distortion, sharp edges, and other defects detrimental to appearance or performance. Shop fabricate sheet metal sections to the maximum extent possible. D. Junctures, intersections, corners and unions of sheet metal shall be held to 18-inch legs or less. E. At all locations where new sheet metal sections abut walls or terminate, the sheet metal flashings shall turn up the wall and be terminated in a watertight condition. Top edge and sides shall be covered with a counterflashing with a reglet mount into masonry, or extending behind new wall panel. Seams shall be soldered or welded unless otherwise indicated to have rivets and sealant. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.7 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 Sealant installation at such transitions is acceptable, but shall not constitute the sole/main waterproofing component of the component. F. Sheet metal flashing shall be fabricated and installed to allow for expansion and contraction of the component materials without buckling, hole elongation, fastener failure, or excess stress loading situations developing at any time during the temperature cycle. Cleats, brackets, and clips shall be designed and installed to resist rotation and to avoid shear stress when roofing materials expand and contract. PART 3 EXECUTION 3.01 SURFACE CONDITIONS AND PREPARATION A. Inspect wood blocking to verify that it is clean, smooth, free of depressions, waves, or projections and solidly supported over joints. B. Verify that roof openings, pipes, sleeves or vents through roof are solidly set. C. Verify installation of all appropriate base and cap flashings have been completed prior to installation of sheet metal. 3.02 INSTALLATION - GENERAL A. Form and install roof system flashings in accordance with the detail drawings. B. Dissimilar metals shall be kept separated to prevent galvanic action. Preventive measures shall include separation by suitable bituminous paint, underlayment, or other non-conductive separation membrane acceptable to the Designer. C. Exposed edges of sheet metal shall be folded back, or "hemmed" ½”, on concealed surfaces. D. Finish sheet metal watertight and weathertight. Lock seams and end joints. Fit flashings tight in- place. Make corners square, surfaces true, and plane surfaces free from warps and buckles. Do not bend flashing around corners or cut/split hemmed edge at outside corners. Corners must be tightly mitered. E. Make seams and joints lap in the direction of water flow. Where end laps/seams do not have a separate joint cover, lap a minimum of 4 inches. F. Install new wall panel and soffit support framing where shown on the detail drawings. Inspect existing support framing at isolated locations where it is noted for reuse and make minor modifications/adjustments if needed for proper installation. Install wall panels and soffit panels over support framing in accordance with the manufacturer’s installation instructions. Concealed fasteners shall be used to secure each panel section to the framing. Panels must be installed without crowning, or poor fit causing oil canning or stresses. Damaged/dented panels will not be accepted and should be replaced immediately if damaged during installation. Vertical joints in the panels must be installed plumb and may not vary more than 1/16” over 4 feet. Panel DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.8 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 joints must be flush along their entire length and may not stand proud of an adjacent panel by more than 1/32” at any one location. G. Fabricate and install eave and rake trim, including gutters and downspouts/brackets/boots as detailed on the drawings.. H. Abrasions, scratches, scrapes, etc. shall be touched up with paint furnished by the sheet metal manufacturer. Physical damage to standing seams or panel edges may result in rejection by the Designer, and require removal and replacement of the panel. Minor damage that is accepted by the Designer must be touched-up to prevent potential corrosion at damaged pre-finish coat. Touch-up paint activities must be coordinated with the Designer to allow for direction by Designer and Owner prior to proceeding. I. Coating for Non-galvanized steel: Apply primer and minimum 2 coats of specified paint. Prepare surfaces to be painted in strict accordance with the paint manufacturer product data and instructions. Evenly apply each coat avoiding holidays, drips, and voids. Take care not to allow painted materials to come into contact before paint is dry. 3.03 COUNTERFLASHINGS A. Form and install new counterflashings along wall transitions, and at other locations shown on the design details. Exact counterflashing length and profile will vary based on configuration of roofing detail. Adjacent counterflashing pieces shall overlap each other a minimum of 4" in the direction of slope (when applicable). B. Counterflashings shall be secured at 6" o.c. maximum unless otherwise noted on the design details. C. Miter counterflashing corners so they nest together without gaps, sharp edges, or open/split corners. Do not cut/split and bend counterflashing around corners. 3.04 GUTTER AND DOWNSPOUTS A. Gutter and downspouts shall be the sizes and general profiles as shown on the design drawings. B. Gutter shall be fabricated in sections not less than 10 feet in length and shall be complete with end pieces, outlet tubes, and special pieces that may be required. Gutter sections shall be lapped a minimum of 2”, joined with rivets at 1” o.c., and sealed between lapped pieces with sealant. Unless otherwise indicated provide expansion joints with cover plates where indicated on the roof plans. Maximum gutter length shall be 50-feet between expansion joints. Gutter size is to match existing. C. Gutter outlet tubes shall be formed with locked longitudinal seam. Upper end of tube shall be riveted to the gutter minimum 4 rivets. Flange shall be sealed against water leakage. Tube shall extend into downspout a minimum of 4" and shall not reduce the gutter size by more than 1/8". DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 076200.9 – FLASHING AND SHEET METAL Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 D. Downspouts shall be rectangular in shape and shall be secured to walls with matching metal straps. Downspout seams shall be concealed along the back surface of or behind the downspout to reduce visibility. E. Provide protective downspout boots at the bottom 2’ of the new downspouts and make connection with existing underground drainage lines (or discharge onto grade where underground drainage is not existing). Provide concrete splashblocks beneath discharge to grade. At landscaped/grass areas, grid-style pavers shall be used in lieu of splashblocks and shall be set into the grade to be level or no more than ½” above grade. (Erase if these will not be included in the scope of work). F. Install pre-fabricated gutter guard to be secured to the gutter in accordance with the manufacturer’s installation instructions. 3.07 CLEAN-UP A. Clean and neutralize all sealant and other materials from the flashing and roof surfaces. Remove loose fasteners from the roof and site on a daily basis. B. Remove any protective plastic materials from the surfaces of the pre-finished metals promptly upon installation. C. Handprints, smudges and other superficial stains that were placed on the sheet metal during fabrication and installation shall be removed. D. Abrasions, scratches, scrapes, etc. shall be touched up with paint furnished by the sheet metal manufacturer. 3.08 FIELD QUALITY CONTROL A. A set of roof plans, details, and specification sections shall be in the possession of the roofing foreman at all times during roof system installation. On-site roofing personnel must be familiar with the requirements of the design documents for the specific project. B. Correct defects and irregularities documented by the Designer or Owner’s representative promptly upon notification. C. Contractor may be requested to install in-place mock-ups of standard sheetmetal installations (scupper, coping, counterflashing, etc.) to allow for Designer review and to ensure acceptable installation prior to continuing with full installation. END OF SECTION 076200 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 0079200.1 – JOINT SEALANTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 079200 JOINT SEALANTS PART 1 GENERAL 1.01 WORK INCLUDED A. Provide labor, materials, equipment and supervision necessary for installation of sealants required as a part of the installation of the roofing system and metal flashings as shown in the detail drawings and as required by the roof system manufacturer. B. Remove and replace existing sealant and install new backing material and sealant joint around opening perimeters at windows and louvers on the south elevation. C. Provide additional labor and materials necessary to properly complete the work specified. 1.02 QUALITY ASSURANCE A. Qualifications of Manufacturer: Products used in this work shall be produced by manufacturers regularly engaged in the manufacture of similar items and with a history of successful production acceptable to the Engineer. B. Installer shall be an experienced installer of the specified products. In acceptance or rejection of the work of this section, the Owner will make no allowance for lack of skill on the part of the workmen. 1.03 SUBMITTALS A. Submit product data and SDS for each product listed in this specification section and others required by the sealant manufacturer for a complete installation of the work. 1.04 DELIVERY, STORAGE, AND HANDLING A. Deliver sealant materials and accessories in manufacturer’s original protective containers with labels intact and legible. Comply with manufacturer’s published instructions for storage and handling. B. Store materials in dry protected areas, on clean, raised platforms with securely anchored weather protective coverings in accordance with Section 016000. C. Store flammable products away from sparks or open flames. D. Maintain temperature and humidity ranges required by the manufacturer for each product. 1.05 ENVIRONMENTAL REQUIREMENTS DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 0079200.2 – JOINT SEALANTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 A. Proceed with work only when weather conditions comply with sealant manufacturer’s recommendations. Do not violate temperature limitations recommended by the manufacturer. 1.06 WARRANTIES A. Provide a Contractor’s Five-Year Warranty for work included in this project in accordance with Section 014000. B. Provide Sealant Manufacturer’s project-specific, Five-Year limited material warranty. Confirm steps necessary to obtain this warranty with the sealant manufacturer as a part of the bidding process. PART 2 PRODUCTS 2.01 SEALANTS A. For sealants to be installed as a part of the roofing system and to be in contact with the roofing shingles, underlayment, or pre-finished sheet metal components, provide only sealant materials specifically required by the roof manufacturer for placement within the warranted system. B. Sealant: Shall be a single-component, non-staining, one-part, low modulus non-sag polyurethane- based sealant in accordance with ASTM C920, Type S, Grade NS, Class 25. Color shall be approved by the Engineer. Acceptable manufacturers/products include, but are not limited to: Sika Corp., Sonneborn Building Products, and Tremco, Inc. Make sure materials are compatible with substrates and are capable of obtaining the specified warranty. C. Cleaner: Shall be xylol, toluene, or commercial solvent recommended by the sealant manufacturer. D. Primer: Primers for substrates shall be as provided by the sealant manufacturer. Primers must be provided and installed whether or not required by the manufacturer. If a sealant manufacturer directly recommends against use of a primer, notify the Engineer to discuss. E. Backing Materials: Provide backing materials such as closed cell backer rod and bond break tape, as required for complete and proper installation of sealants. Size of backing materials must be determined by the joint size to be sealed and must be of adequate size to create the proper joint depth and prevent three-sided adhesion. F. Protection Materials: Provide materials such as polyethylene sheeting, tape, and other accessories as required to protect other building features from damage or staining, due to joint sealant replacement. PART 3 EXECUTION 3.01 SURFACE EXAMINATION AND PREPARATION A. Examine area and condition under which work of this section will be performed. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 0079200.3 – JOINT SEALANTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 B. Correct conditions detrimental to the proper and timely completion of the work. Do not proceed until unsatisfactory conditions have been corrected. C. Locate joints to be prepared and confirm widths and lengths to ensure proper materials are on hand. D. Do not add liquids, solvents, or powders to the sealant. Mix multi-component elastomeric sealants in accordance with manufacturer’s instructions. E. Thoroughly remove all existing materials (sealants, backer rod, mortar, etc.) from the existing joint. Resulting joint shall be thoroughly cleaned to remove residue, and properly prepared to receive new materials. Use mechanical means for cleaning if necessary being careful not to cause damage to surrounding surfaces. F. All surfaces to be in contact with sealant shall be dry, sound, and well brushed and wiped free from dust. G. Remove and replace sealant at the windows prior to installation of new metal wall panels and associated flashings. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 0079200.4 – JOINT SEALANTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3.02 INSTALLATION OF SEALANT A. Masking: Thoroughly and completely mask all joints where the appearance of primer or sealant on adjacent surfaces would be objectionable. Do not apply primer to exposed finish surfaces. B. Apply primer to joints in accordance with sealant manufacturer’s instructions. Do not apply primer to exposed finish surfaces. Primer application will be required whether or not required by the manufacturer. Primer use will only be waived if specifically recommended against, in writing for this specific project condition, by the manufacturer. Apply primer in a thin, uniform film. Avoid build-up of film. C. Allow primer drying time prior to applying sealant. Sealant must be applied same day as primer. D. Backing Materials: Install backing materials into the joints to provide proper joint depth to width ratio and to prevent three-sided adhesion. Select backer rod diameter to allow for proper fit without shifting or tearing/deforming of the material. Do not puncture, twist, or braid the backer rod material during installation. If proper joint depth is not available with backer rod use, utilize bond breaker tape. E. Apply sealant under pressure with hand or power-actuated gun or other appropriate means. Guns shall have nozzle of proper size and shall provide sufficient pressure to completely fill joints as designed. F. Install the sealant in strict accordance with the manufacturer's recommendations as approved by the Designer, thoroughly filling all joints to the recommended depth. G. No air voids/bubbles shall be present within the cross-section of the joint. To ensure complete joint fill, tooling shall be performed within ten to fifteen minutes of sealant application (prior to skinning). Sealant shall be tooled with light pressure to spread the material against the sides of the joint and provide a profile to match existing. Do not smear sealant onto surrounding surface of the window/louver frames. H. Sealant shall be dry tooled unless specifically approved otherwise by the manufacturer and the Designer. If the sealant manufacturer approves, the tool may be dampened with a sealant manufacturer approved reducer. Water or soapy water shall not be used on the tool. 3.03 FIELD QUALITY CONTROL A. The installer shall perform adhesion and cohesion testing on sample sealant joint locations once cured to ensure that cleaning, priming, and sealant installation was performed adequately. If the Designer is not present at the testing, provide a written confirmation of acceptance by the Manufacturer for their warranty. DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 0079200.5 – JOINT SEALANTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 3.04 CLEANING UP A. Remove masking tape immediately after joints have been tooled. B. Keep adjacent surfaces clean and free from sealant as the installation progresses. Use solvent or cleaning agent as recommended by the sealant manufacturer. C. Do not allow uncured sealants to contact surfaces adjacent to the joints, or any other non-joint surfaces. If uncured sealants are introduced to prohibited areas, sealant shall be removed as follows: 1. Non-porous Surfaces - Immediately remove all excess sealant adjacent to the joint and elsewhere by using an appropriate solvent or cleaner while sealant is still in uncured state. 2. Porous Surfaces - Allow sealant to develop initial cure, then remove by abrasion or other mechanical means. Exercise extreme care to maintain the original surface texture without damage. END OF SECTION 079200 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 230800.1- GENERAL MECHANICAL AND ELECTRICAL REQUIREMENTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 SECTION 230800 GENERAL MECHANICAL AND ELECTRICAL REQUIREMENTS PART 1 GENERAL 1.01 WORK INCLUDED A. Provide labor, materials, equipment, coordination and supervision necessary for disconnection, relocation, reinstallation, reconnection, and minor modification of existing rooftop mechanical equipment or penetrations, and the utilities serving them including, but not limited to: conduit, duct work, electrical wiring, communications, controls, pneumatic lines, and/or mechanical components/services associated with raisin, lifting, or otherwise disturbing existing components during roof replacement work. Coordinate work with the Owner’s Representative. B. Provide materials, equipment and supervision necessary for other miscellaneous electrical and/or mechanical work not specifically listed but required for complete and proper installation of the work as specified herein or shown on the drawings. C. Coordinate any inspections required for mechanical, electrical, or plumbing work performed with public agency providing the building permit for the work. Inspections must be scheduled to be timely and not delay the project progress. 1.02 QUALITY ASSURANCE A. Perform mechanical and electrical work in accordance with the latest adopted editions of the North Carolina State Building Code, The North Carolina Department of Administration Electrical Guidelines and Policies the National Mechanical Code, the National Electrical Code, EPA, NFPA, and other applicable Owner-permitted regulations. B. In addition to compliance with laws and regulations stated in Paragraph 1.02A, work shall conform to applicable standards of UL, ASME, ANSI, and other authorities or agencies to which specific reference is made by specifications and/or by the manufacturer’s installation instructions. C. Work must be performed by licensed electrical or mechanical contractors that are currently approved by the Owner to perform work at their facilities. Contact information regarding approved contractors can be obtained from the Owner’s Representative. D. The Contractor shall secure and pay for all necessary permits, fees and inspections and prepare all drawings required by applicable state and local codes. F. Check all equipment/components to ensure it is in proper working order prior to construction. Notify the Designer/Owner of any equipment that is damaged or is not working properly. Any equipment/components found to be damaged or not in working order after the beginning of construction will be repaired/replaced by the Contractor at no cost to the Owner. 1.03 SUBMITTALS DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 230800.2- GENERAL MECHANICAL AND ELECTRICAL REQUIREMENTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 A. Submit records of any damages as a part of the Pre-Job Damage Survey (required by Section 024110) that includes documentation of existing component locations and documentation of the condition of units/services including interior components and exterior housing of equipment/systems prior to performing any disconnection or modifications to them. B. Upon completion of work reconfirm equipment remains in working condition. If modifications were required, provide copies of all applicable inspections and certification from the licensed Contractor or Sub-contractor confirming that the work is in conformance with the applicable standards. 1.04 WARRANTY A. If replacement of an existing mechanical or electrical component(s) is necessary, due to damage during construction activities, replacement will be performed at no cost to the Owner and the equipment or component manufacturer’s standard product warranty shall be provided in addition to the Contractor’s five year warranty against defects of materials and workmanship. PART 2 PRODUCTS 2.01 MATERIALS A Provide materials and accessories (such as ductwork, wood blocking, electrical wiring, control wiring, etc.) required for a complete and proper installation of the work as specified herein and on the project drawings in accordance with applicable local, state, and federal codes and regulations. B. Materials and equipment shall bear certification of UL, ASME where such labels are customary, required, or specified. PART 3 EXECUTION 3.01 DOCUMENTATION OF EXISTING CONDITIONS A. Document locations of units, fixtures, piping/conduit and other services. B. Inspect and test each unit, service, fixture, and component that may require modification, disconnection and/or relocation to confirm working order. Coordinate with the Owner to allow for them to be present during inspection. 3.02 DISCONNECTION/RECONNECTION OF MECHANICAL AND ELECTRICAL SERVICES A. Disconnect mechanical piping, electrical/control wiring, conduit, or other components to allow for safe temporary movement from their existing locations as necessary to accommodate proper installation of the new roof system, flashing of utility penetrations, and associated components shown on the drawings. B. Work shall be performed in accordance with specified codes and regulations. It is the responsibility of the contractor to make all necessary investigations of the existing electrical and mechanical DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 230800.3- GENERAL MECHANICAL AND ELECTRICAL REQUIREMENTS Project Manual for Motor Pool Main Building Roof Replacement Orange County, Hillsborough, NC Prepared by Atlas Engineering, Inc., 551-A Pylon Drive – Raleigh, NC 27606 August 2021 units/components to determine which items may require modification, disconnection, raising or removal of the cover or other components to accommodate flashing installation, prior to the bid. Necessary costs for disconnection and reconnection of existing mechanical and electrical systems as required for proper installation of the new roof systems shall be included in the base bid. C. Once services have been reconnected, test equipment and components to ensure that they are in working condition and meet or exceed the condition as documented in the pre-job condition survey. Obtain Owner approval/agreement that components are in acceptable working order. D. If physical damage to units and/or systems is observed, or units and/or systems are not in working condition and the damages were not previously listed on the pre-job condition survey, the equipment or service shall be repaired by the Contractor at no cost to the Owner. If testing indicates that units are not performing as documented in the pre-job condition survey, provide necessary services, at no cost to the Owner, to assure the proper operation of the unit and/or system. END OF SECTION 230800 DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E 10/11/2021 Kitzi BassO'Berry & Lewis, Inc. PO Box 127 Goldsboro NC 27533 www.oberry-lewis.com 919 735 1237 919 735 8819 kitzib@oberry-lewis.com West Best Mutual Insurance Company 15350 Wayne Roofing & Sheet Metal, Inc. PO Box 941 Goldsboro NC 27533 A Y A A Blanket Additional Insured as required by written contract or agreement. Email: abarnes@orangecountync.gov Orange County Asset Management Services 300 West Tryon St Bldg B 3rd Floor Office 10 Hillsborough, NC 27278 A911688 05/01/2021 05/01/2022 1,000,000 300,000 5,000 1,000,000 2,000,000 2,000,000 A911688 05/01/2021 05/01/2022 1,000,000 A911688 05/01/2021 05/01/2022 2,000,000 2,000,000 ANY PROPRIETOR/PARTNER/EXECUTIVE OFFICER/MEMBER EXCLUDED? INSR ADDL SUBR LTR INSD WVD DATE (MM/DD/YYYY) PRODUCER CONTACTNAME: FAXPHONE(A/C, No):(A/C, No, Ext): E-MAILADDRESS: INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : POLICY NUMBER POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITS(MM/DD/YYYY)(MM/DD/YYYY) AUTOMOBILE LIABILITY UMBRELLA LIAB EXCESS LIAB WORKERS COMPENSATION AND EMPLOYERS' LIABILITY DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) AUTHORIZED REPRESENTATIVE EACH OCCURRENCE $ DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person)$ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGG $JECT OTHER:$ COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$ OWNED SCHEDULED BODILY INJURY (Per accident)$AUTOS ONLY AUTOS HIRED NON-OWNED PROPERTY DAMAGE $AUTOS ONLY AUTOS ONLY (Per accident) $ OCCUR EACH OCCURRENCE $ CLAIMS-MADE AGGREGATE $ DED RETENTION $ $ PER OTH-STATUTE ER E.L. EACH ACCIDENT $ E.L. DISEASE - EA EMPLOYEE $ If yes, describe under E.L. DISEASE - POLICY LIMIT $DESCRIPTION OF OPERATIONS below INSURER(S) AFFORDING COVERAGE NAIC # COMMERCIAL GENERAL LIABILITY Y / N N / A (Mandatory in NH) SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION © 1988-2015 ACORD CORPORATION. All rights reserved. The ACORD name and logo are registered marks of ACORDACORD 25 (2016/03) CERTIFICATE OF LIABILITY INSURANCE DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E ANY PROPRIETOR/PARTNER/EXECUTIVE OFFICER/MEMBER EXCLUDED? INSR ADDL SUBR LTR INSD WVD PRODUCER CONTACT NAME: FAXPHONE (A/C, No):(A/C, No, Ext): E-MAIL ADDRESS: INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : POLICY NUMBER POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITS(MM/DD/YYYY)(MM/DD/YYYY) AUTOMOBILE LIABILITY UMBRELLA LIAB EXCESS LIAB WORKERS COMPENSATION AND EMPLOYERS' LIABILITY DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) AUTHORIZED REPRESENTATIVE EACH OCCURRENCE $ DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person)$ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGGJECT OTHER:$ COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$ OWNED SCHEDULED BODILY INJURY (Per accident)$AUTOS ONLY AUTOS HIRED NON-OWNED PROPERTY DAMAGE $AUTOS ONLY AUTOS ONLY (Per accident) $ OCCUR EACH OCCURRENCE CLAIMS-MADE AGGREGATE $ DED RETENTION $ PER OTH- STATUTE ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE $ If yes, describe under E.L. DISEASE - POLICY LIMITDESCRIPTION OF OPERATIONS below INSURER(S) AFFORDING COVERAGE NAIC # COMMERCIAL GENERAL LIABILITY Y / N N / A (Mandatory in NH) SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF, NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED. NOTWITHSTANDING ANY REQUIREMENT, TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN, THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER. THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND, EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW. THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S), AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT: If the certificate holder is an ADDITIONAL INSURED, the policy(ies) must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED, subject to the terms and conditions of the policy, certain policies may require an endorsement. A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION © 1988-2015 ACORD CORPORATION. All rights reserved.ACORD 25 (2016/03) CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) $ $ $ $ $ The ACORD name and logo are registered marks of ACORD 10/11/2021 (803) 732-0060 (803) 407-5400 20006 Wayne Roofing & Sheet Metal Co., Inc. PO Box 941 Goldsboro, NC 27533 A CRS0000084 1/1/2021 1/1/2022 1,000,000 N 1,000,000 1,000,000 Orange County, AMS PO Box 8181 Hillsborough, NC 27278 WAYNROO-01 XDGCPADILLA AssuredPartners of SC, LLC - Columbia PO Box 21627 Columbia, SC 29221-1627 Carolinas Roofing & Sheet Metal Contractors SIF X DocuSign Envelope ID: 9514E4EC-C3C9-4752-8A7F-22E83B22BB8E