Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2020-865-E AMS-BAR Roofing and Maintenance Sportsplex roof repair
Revised 07/20 1 [Departmental Use Only] TITLE Splex Roof Replacement FY 2020-2021 NORTH CAROLINA CONSTRUCTION AGREEMENT OVER $50,000.00 ORANGE COUNTY THIS CONSTRUCTION AGREEMENT (hereinafter called “Agreement”), made as of the 28th day of December, 2020, by and between BAR Roofing and Maintenance, (hereinafter called the “Contractor”), and Orange County, a political subdivision of the State of North Carolina, (hereinafter called the “County,” “Orange County,” or “Owner”). W I T N E S S E T H: That the Contractor and the Owner, for the consideration herein named, agree as follows: 1. CONTRACT DOCUMENTS; PRIORITY The Contract Documents consist of this Agreement , the General Conditions which are fully incorporated in this Agreement, the Request for Proposals, designer approved communications and field orders, the Proposal, Construction Documents and Drawings and Written Specifications. The Contract Documents form the Contract. In the event of a ny inconsistency between or among the Contract Documents the Contract Documents shall be interpreted in the following order of priority: a. This Agreement and incorporated General Conditions attached as Exhibit 1. b. Designer approved and stamped construction documents and drawings and written specifications. c. Designer approved communications and field orders. d. Request for Proposals and addenda thereto. e. Proposal. 2. SCOPE OF WORK The Contractor shall furnish and deliver all of the materials, and perform, and be fully responsible for all of the Work required by this Agreement within the time period stipulated in a written Notice -to-Proceed to be executed by the Contractor and Owner and in accordance with the following enumerated documents, which are made a part hereof as if fully contained herein: a. Construction Drawings prepared by Atlas Engineering, Inc (Sheet COV, 1.0, 2.0, 3.0, 4.0 dated August 4, 2020, Project Manual Dated, August, 2020, and Addenum 1 dated 10 -1-2020, Addendum 2 dated 10-16-20, and Addendum 3 dated 10-19-2020) b. Written specifications prepared by the Designer. c. BAR Roofing and Maintenance proposal dated October 20, 2020 which fully describes the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 2 work to be performed, such work (hereinafter called the “Work”). d. Related documents listed under Section 2 above. 3. TERM AND SCHEDULING a. The Contractor agrees to commence work pursuant to the written Notice-to Proceed. b. The Contractor agrees to complete substantially all Work included by April 26, 2021. c. Time is of the essence with respect to all dates specified in the Contract Documents as Completion Dates. d. The Contractor shall perform the Work in the time, manner and form required by the Contract Documents and as stipulated in a written Notice-to-Proceed to be executed by the Contractor and Owner. 4. STANDARD OF CARE AND DUTIES OF CONTRACTOR a. The Contractor shall exercise reasonable care and diligence in performing the Work in accordance with the generally accepted standards of this type of Contractor practice throughout the United States and in accordance with applicable federal, state and local laws and regulations applicable to the performance of these services. Contractor is solely responsible for the professional quality, accuracy and timely completion and submission of all work. b. The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance or configuration. c. Contractor shall be responsible for all Contractor, Subcontractor, and Sub-subcontractor errors or omissions, in the performance of the Agreement together with the errors and omissions of any agent or employee of the Contractor or any Subcontractor or Sub-subcontractor. Contractor shall correct any and all errors, omissions, discrepancies, ambiguities, mistakes or conflicts at no additional cost to the Owner. d. Contractor is an independent contractor of Owner. Any and all employees of the Contractor engaged by the Contractor in the performance of any work or services required of the Contractor under this Agreement, shall be considered employees or agents of the Contractor only and not of the Owner, and any and all claims that may or might arise under any workers compensation or other law or contract on behalf of said employees while so engaged shall be the sole obligation and responsibility of the Contractor. e. Contractor shall at all times remain in compliance with all applicable local, state, and federal laws, rules, and regulations including but not limit ed to all state and federal non-discrimination laws, policies, rules, and regulations and the Orange County Non-Discrimination Policy and Orange County Living Wage Policy (each policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Any violation of the Orange County Non-Discrimination Policy is a breach of this Agreement and County may immediately terminate this Agreement without further obligation on the part of the County. This paragraph is not intended to limit and does not limit the definition of breach to discrimination. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 3 f. If activities related to the performance of this Agreement require spec ific licenses, certifications, or related credentials Contractor represents that it and its employees, agents and subcontractors engaged in such activities possess such licenses, certifications, or credentials and that such licenses certifications, or credentials are current, active, and not in a state of suspension or revocation. g. The Contractor shall supervise and direct the Work efficiently and with the Contractor’s best skill and attention. Except as specifically set forth in the Contract Documents th e Contractor shall be solely responsible for the means, methods, techniques, sequences and procedures of construction, and for safety precautions and programs in connection with the Work. The Contractor shall be responsible to see that the finished Work c omplies accurately with the Contract Documents. h. The Contractor shall appoint a competent Project Manager with general authority to manage the Project for the Contractor. The Contractor shall also keep on the Project at all times during the Work of the Contractor a competent Resident Superintendent and necessary assistants who shall not be replaced without prior written approval by the Designer or by the Owner if a Designer is not retained for the Project. i. If, in the opinion of the Designer, any Subcontractor on the Project is incompetent or otherwise unsatisfactory, such Subcontractor shall be replaced by the Contractor with no increase in the Contract Price if and when directed by the Designer. j. The Contractor shall attend all progress conferences and all other meetings or conferences. The Contractor shall be represented at these progress conferences by a representative having the authority of the Project Manager and by such other representatives as the Designer may direct. k. Costs and expenses of providing samples for and assistance in any testing shall be borne by the Contractor. Any Work in which untested materials are used without written approval or written permission of the Owner or Designer shall be removed and replaced at Contractor’s expense. l. The Contractor shall obtain all necessary permits including all permits required to complete the Work in compliance with local, state, and federal law. 5. PAYMENT & TAXES a. The Owner hereby agrees to pay to the Contractor for the faithful performance of t his Agreement, and the Contractor hereby agrees to perform all of the Work for a sum not-to- exceed Four Hundred Twenty Nine Thousand Fifty Dollars ($429,050.00). Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Owner’s Representative, generally the Designer if a Designer is retained on the Work, a Request for Payment for work done during the previous calendar month. (i) The Request for Payment shall be in form of a standardized invoice or AIA Document G702-703 appropriately addressed to Owner’s Representative at 551-A PYLON DRIVE RALEIGH, NORTH CAROLINA 27606 JOB NO. J2400 and shall show substantially the value of work done during the previous calendar month. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 4 (ii) The amount due for payment shall be ninety-five percent (95%) of the value of work completed since the last Request for Payment and this amount shall be paid by the Owner on or before the last business day of the month. Owner shall retain five percent (5%) (the “Retainage”). (1) Upon Owner’s Representative’s certification that fifty percent (50%) of the Work has been satisfactorily completed Retainage shall be reduced to two and one half percent (2½%). (2) Upon Owner’s Representative’s certification that ninety percent (90%) of the Work has been satisfactorily completed Retainage may be discontinued. Retainage may be discontinued, at Owner’s Discretion, so long as work continues to be completed satisfactorily and on schedule. (iii) Final payment shall not be due to the Cont ractor until thirty (30) days after Final Completion of the Work, including punch list work, has been satisfactorily (as determined by the County) completed and an appropriate Affidavit, Indemnification, and Release as required in Section 8(d) below has been received by Owner. b. Should Owner reasonably determine that Contractor has failed to perform the Work related to a Request for Payment, Owner, at its discretion may provide the Contractor ten (10) days to cure the breach. Owner may withhold the accompanying payment without penalty until such time as Contractor cures the breach. (i) Should Contractor or its representatives fail to cure the breach within ten (10) days, or fail to reasonably agree to such modified schedule, Owner may immediately terminate this Agreement in writing, without penalty or incurring further obligation to Contractor. (ii) This section shall not be interpreted to limit the definition of breach to the failure to perform the Work related to a Request for Payment. c. The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. It shall be the Contractor's responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of its subcontractors. d. Should the Owner receive notice that the Contractor has failed to pay a Subcontractor for the Work performed related to a Request for Payment, Owner shall have the authority to withhold payment of the disputed amount until parties resolve their dispute. Failure to pay the Contractor pursuant to this section of the Agreement shall not be deemed to be a breach of the Agreement. 6. NON–APPROPRIATION a. Contractor acknowledges that Owner is a governmental entity, and the validity of this Agreement is based upon the availability of public funding under the authority of its statutory mandate. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 5 b. In the event that public funds are unavailable and not appropriated for the performance of Owner’s obligations under this Agreement, then this Agreement shall automatically expire without penalty to Owner immediately upon written notice to Contractor of the unavailability and non-appropriation of public funds. It is expressly agreed that Owner shall not act ivate this non-appropriation provision for its convenience or to circumvent the requirements of this Agreement, but only as an emergency fiscal measure during a substantial fiscal crisis. c. In the event of a change in the Owner’s statutory authority, mandat e or mandated functions, by state or federal legislative or regulatory action, which adversely affects Owner’s authority to continue its obligations under this Agreement, then this Agreement shall automatically terminate without penalty to Owner upon writt en notice to Contractor of such limitation or change in Owner’s legal authority. 7. NOTICES Any notice required by this Agreement shall be in writing and delivered by certified or registered mail, return receipt requested to the following: Owner: Contractor: Orange County BAR Roofing and Maintenance Attn: AMS Attn: Nathan Darrah P.O. Box 8181 2237 Bethel Church Road Hillsborough, NC 27278 Kernersville, NC 27284 8. MISCELLANEOUS a. Duties and Obligations imposed by the Contract Documents shall be in addition to any Duties and Obligations imposed by state, federal or local law, rules, regulations and ordinances. b. No act or failure to act by the Owner or Contractor shall consti tute a waiver of any right or duty granted them under the Contract Documents, nor shall any act or failure to act constitute any approval except as specifically agreed in writing. c. The Work shall be tested and inspected as required by the Contract Document s and as required by law. Unless prohibited by law the costs of all such tests and inspections related to state and federal codes such as ADA, Administrative, Electrical, Plumbing, Mechanical and Building Codes shall be borne by the Contractor. The costs for material and structural testing shall be conducted by an independent third party at the expense of the Owner. Delays related to any of the aforementioned tests and inspections shall not be grounds for delaying the completion of the work. If any such tests and inspections reveal deficiencies in the Work such that the Work does not comply with terms or requirements of the Contract Documents and the requirements of any code or law the Contractor is solely responsible for the cost of bringing such deficiencies into compliance with the terms of the Contract Documents and any code or law. d. Should the Designer, if a Designer is retained for the project involving the Work, or Owner reject any portion of the Work for failing to comply with the Contract Documents Contractor shall immediately, at Contractor’s expense, correct the Work. Any such rejection may be made before or after substantial completion. If applicable, any additional expense borne by the Designer under this section shall be paid at Contractor’s expense. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 6 e. The County has designated (Angel Barnes) to act as the County's representative with respect to the Project and shall have the authority to render decisions within guidelines established by the County Manager or the County Board of Commissioners and shall be available during working hours as often as may be reasonably required to render decisions and to furnish information. f. The Contractor shall not assign any portion of this Agreement nor subcontract the Work in its entirety without the prior written consent of the Owner. g. In the event of a breach by Contractor Owner has sole authority to determine the reasonableness of Contractor’s actions to remedy such breach or complete the performance of its obligations. h. Upon request of the Owner, the Contractor shall submit to County all relevant documentation, including but not limited to, job cost records, to support its claims for final compensation and if such request is made final compensation shall not be due until all relevant docum entation is received, reviewed, and approved by Owner. 9. CONSEQUENTIAL DAMAGES a. Owner and Contractor mutually waive any claim against each other for consequential damages. Consequential Damages include: (i) Damages incurred by Owner for loss of use, income, financing, or business. (ii) Damages incurred by Contractor for office expenses, including personnel, loss of financing, profit, income, business, damage to reputation, or any other non-direct damages. 10. ENTIRE AGREEMENT All of the documents listed, referenced or described in this Agreement, the written Notice-to-Proceed, together with Modifications made or issued in accordance herewith are the Contract Documents, and the work, labor, materials, and completed construction required by the Contract Documents a nd all parts thereof is the Work. The Contract Documents constitute the entire agreement between Owner and Contractor. This Agreement may be amended only by written instrument signed by both parties. Modifications may be evidenced by facsimile signatures. If any provision of the Agreement or General Conditions shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. [SIGNATURE PAGE TO FOLLOW] DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 7 IN WITNESS WHEREOF, the Parties hereto have executed this Agreement as of the day and date first above written in a number of counterparts, each of which shall, without proof or accounting for other counterparts, be deemed an original contract. ORANGE COUNTY: CONTRACTOR: By: _________________________________ Bonnie Hammersley, County Manager By: __________________________________ Nathan Darrah, Owner Printed Name and Title DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 12/14/202012/23/2020 Revised 07/20 8 ORANGE COUNTY—DEPARTMENT USE ONLY ______________________________________________________________________________ Party/Vendor Name: BAR Roofing and Maintenance Party/Vendor Contact Person: Nathan Darrah (nathan.barrfg@gmail.com) Contact Phone: 336.782.7108 Party/Vendor Address: 2237 Bethal Church Road City Kernersville State: NC Zip: 27284 Department: AMS/Sportsplex Amount: $429,050.00 Purpose: Sportsplex Main Building Roof Replacement Budget Code(s): 54540030 880000 Vendor # 66791 (N/A if new vendor) Vendor is a BOCC consultant? Yes No Contract Type: (Check one) New Renewal Amendment Effective Date 12/28/2020 Approved by Board Yes No Agenda Date: 12/7/2020 This agreement is approved as to technical form and content and I as Department Director affirmatively state work on this project has not been initiated prior to execution of the agreement: Department Director’s Signature ________________________________________ Date: ________ Agreements for emergency services or repair are not subject to the above affirmation. If services related to this agreement have already begun or been completed please briefly describe the nature of the emergency condition that was addressed: N/A Risk Management This agreement is approved for sufficiency of insurance standards, specifications, and requirements: Office of the Risk Management Officer___________________________________ Date: _________ Financial Services This instrument has been pre-audited in the manner required by the Local Government Budget and Fiscal Control Act: Office of the Chief Financial Officer ____________________________________ Date: _________ Legal Services This agreement is approved as to legal form and sufficiency: Office of the County Attorney __________________________________________Date: ________ Clerk to the Board Received for record retention: All Docusign contracts must be copied to the Clerk upon completion: occlerkdocs@orangecountync.gov The following signature block is for hard copies only and is not required for Docusign contracts: Office of the Clerk to the Board __________________________________________Date:_________ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 12/15/2020 12/17/2020 12/22/2020 12/22/2020 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 1 Revised 07/20 EXHIBIT 1----GENERAL CONDITIONS Table of Contents Page Article 1. Definitions......................................................................................................................3 Article 2. Correlation, Interpretation, and Intent of Contract Documents……...............................7 Article 3. Familiarity with Work, Conditions and Laws..................................................................8 Article 4. Bonds............................................................................................................................9 Article 5. Insurance and Indemnity ..............................................................................................9 Article 6. Other Record Documents and Submittals...................................................................16 Article 7. Contractor....................................................................................................................18 Article 8. Owner .........................................................................................................................26 Article 9. Construction Manager ................................................................................................26 Article 10. Designer ...................................................................................................................26 Article 11. Testing and Surveying..............................................................................................27 Article 12. Separate Contracts...................................................................................................27 Article 13. Contract Time ..........................................................................................................28 Article 14. Changes in the Work ...............................................................................................31 Article 15. Change of the Contract Price ..................................................................................33 Article 16. Unforeseen Conditions.............................................................................................35 Article 17. Correction of Work before Final Payment ...............................................................35 Article 18. Correction of Work after Substantial Completion; Warranties and Guaranties........36 Article 19. Owner's Right to Do Work .......................................................................................37 Article 20. Partial Payments .....................................................................................................37 Article 21. Final Payment..........................................................................................................40 Article 22. Contractor, Subcontractor and Supplier Affidavit ....................................................41 Article 23. Assignments and Subcontracts................................................................................41 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 2 Revised 07/20 Article 24. Measurements........................................................................................................41 Article 25. Contractor and Subcontractor Relationships..........................................................42 Article 26. Use of Premises .....................................................................................................42 Article 27. Cutting, Patching and Fitting ..................................................................................42 Article 28. Dispute Resolution ................................................................................................43 Article 29. Taxes......................................................................................................................43 Article 30. Operation of Owner's Facilities...............................................................................44 Article 31. Third Party Beneficiary Clause...............................................................................44 Article 32. Measurement of Quantities ....................................................................................44 Article 33. Termination by the Owner for Cause .....................................................................44 Article 34. Termination or Suspension by the Owner for Convenience...................................45 Article 35. Minority Business Enterprise Program……………………….……………………….46 Article 36 E-Verify, Iran Divestment, Israel Boycott, and Digital.……………………………..46 Article 37. General...................................................................................................................46 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3 Revised 07/20 ARTICLE 1. DEFINITIONS 1.1 Agreement - The Construction Contract, these General Conditions, and any Supplementary Conditions. 1.2 AIA - The American Institute of Architects. 1.3 ASTM - The American Society for Testing and Materials. 1.4 Beneficial Occupancy – Use of the Project by the Owner after Substantial Completion, but prior to Final Completion.. 1.5 Change Order - A written order to the Contractor signed by the Owner and the Designer authorizing an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time issued after execution of the Construction Contract. See paragraph 14.1. 1.6 Completion Date - Those dates identified as Completion Dates in the Contract Construction Schedule or elsewhere in the Contract Documents. 1.7 Construction Contract – The document executed by the Contractor and the Owner to formally memorialize their consent to the terms of the Agreement. 1.8 Construction Change Directive – A written order to the Contractor signed by the Owner and the Designer directing an addition, deletion, or revision in the Work after execution of the Construction Contract, in circumstances when the parties have been unable to agree on an adjustment to the Contract Price or the Contract Time, but the Owner requests that the Contractor proceed with said addition, deletion, or revision in the Work subject to adjustment of the Contract Price or Contract Time under the procedures described herein. 1.9 Construction Manager(s) - The person(s) or firm designated as the Construction Manager in the Contract Documents, or their authorized representatives. The Construction Manager(s), as referred to herein, will be referred to hereinafter as if each were of the singular number and masculine gender. 1.10 Contract Construction Schedule - That schedule described in Article 13 hereof and identified as the Contract Construction Schedule. 1.11 Contract Documents - All of the documents that make up the Agreement, plus the Drawings and Specifications that describe the scope of the Work, plus allowable Modifications to the Contract Documents. 1.12 Contract Price - The total monies payable to the Contractor under the Contract Documents pursuant to paragraph 15.1 of the Agreement. 1.13 Contract Time - The number of calendar days stated in, or computed from, the Contract Documents for the completion of the Work, or any portion thereof. See, particularly, Article 13 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 4 Revised 07/20 hereof and the Contract Construction Schedule. Time of completion as specified therein is of the essence. The time used and referred to on the Project will be that time which is observed in Raleigh, North Carolina, being Eastern Daylight Savings Time (EDT), Eastern Standard Time (EST), or other as designated by the Designer. 1.14 Contractor - The Contractor shall be that party identified as such in the Contract Documents. 1.15 Days - Unless otherwise indicated, the term "days" shall mean consecutive calendar days. 1.16 Daylight Hours - The hours or portions of hours between sunrise and sunset local time. 1.17 Designer(s) – The person or firm designated as the Designer in the Contract Documents, or their authorized representatives. The Designer(s), as referred to herein, shall mean architect, landscape architect, or engineer. They will be referred to hereinafter as if each were of the singular number and masculine gender. On projects for which there is no Designer designated references to approvals or authorizations of or by the Designer shall be interpreted to refer to approvals or authorizations of Owner or Owner’s designee. 1.18 Drawings - The Drawings are the graphic and pictorial portions of the Contract Documents, wherever located and whenever issued, showing the design, location, and dimensions of the Work, and generally including plans, elevations, sections, details, schedules and diagrams. A list of the Drawings is contained in the Contract Documents. 1.19 Field Order - A written order issued by the Designer which clarifies or interprets the Contract Documents or orders minor changes in the Work in accordance with the Contract Documents. See paragraph 14.2. 1.20 Final Completion - The point at which the Contractor has completed the Work, with the exception of guaranty and warranty obligations and as determined by the Designer and becomes entitled to final payment upon the recommendation of the Designer and determination by the Owner. 1.21 The words "furnish," "furnish and install," "install," and "provide" or words with similar meanings shall be interpreted, unless otherwise stated, to mean furnish and install complete, in place and ready for service. 1.22 Liquidated Damages – See paragraph 13.18 of these General Conditions. 1.23 Modification - (A) a written amendment to the Contract Documents signed by the Owner and the Contractor and identified therein as such, (B) a Change Order, (C) Construction Change Directive, or (D) a Field Order. A Modification may only be issued after execution of the Agreement. 1.24 Notice of Award - The written notice by the Owner to the Contractor that the Contractor is the successful Bidder and that upon compliance with the conditions precedent to be fulfilled by the Contractor within the time specified, the Owner will execute and deliver the Agreement to him. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 5 Revised 07/20 1.25 Notice to Proceed - See paragraph 13.3. 1.26 Owner - The Owner is the person designated as such in the Agreement. 1.27 Owner's Representative - A person, or persons, authorized and employed by the Owner and designated from time to time by written notice to the Contractor to administer the Contract Documents, and to observe and monitor the Work on behalf of the Owner with authority and responsibility as herein specified. 1.28 Notice - The term "notice" or "written notice" as used herein shall mean and include all written notices, demands, instructions, and claims approvals and disapprovals furnished by the Owner or the Designer to obtain compliance with the requirements of the Contract Documents, as well as all written notices, demands, instructions and claims furnished by the Contractor as required by the Contract Documents. Where notice is required under the terms of the Contract Documents written notice shall always be required, and oral or "constructive" notice shall be insufficient and ineffective as notice. Email or other electronic delivery shall be insufficient and ineffective as notice unless specifically allowed by the Supplementary Conditions or a Modification to the Agreement. Written notice shall be deemed to have been duly served on the date that it is delivered in person to the individual or to a member of the firm, to an officer of the corporation for whom it is intended, to an authorized representative of such individual, firm, or corporation, or on the date that it is mailed by registered or certified mail, return receipt requested, addressed to the last business address of such individual, firm, or corporation known to the person giving the notice. Written notice may also be given by facsimile transmission, provided that proof of delivery is obtained. In the case of delivery in person, such delivery shall not be effective unless and until a written and signed receipt showing the date and time of delivery is obtained. 1.29 Project - The total construction of which the Work performed under the Contract Documents may be the whole or a part. 1.30 Project Expediter – As used herein, is an entity stated in the Contract Documents, designated to effectively facilitate scheduling and coordination of Work activities. For the purpose of a single prime contract, the single prime contractor is designated as the Project Expediter. For the purpose of a project involving separate prime contracts, the Contractor for general work shall be designated as the Project Expediter unless otherwise indicated in the Supplementary General Conditions. See paragraph 7.27. 1.31 Project Manager - That person designated by the Contractor in accordance with paragraph 7.2 who shall be in general charge of the Work and its performance and who shall have the authority set forth in the last sentence of paragraph 7.2. 1.32 Request for Information - A written communication from the Contractor to the Designer for any interpretation of, or information needed, required, or desired under the Contract Documents. The Owner reserves the right to determine the reasonable format and contents required for a Request for Information. In any Request for Information, the Contractor shall state a reasonable date by which a response is necessary in order to avoid delay in progress on the Work and shall make such request sufficiently in advance of such date as to avoid any such delay. The Designer shall respond in writing to the Request for Information by the date stated by the Contractor unless he cannot reasonably do so, in which case he shall prior to that date notify DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 6 Revised 07/20 the Contractor of the date by which he can reasonably respond. The Contractor shall not be entitled to any additional time for the completion of the Work or any portion thereof by reason of the Designer's failure to respond if he has not submitted his Request for Information sufficiently in advance to allow the Designer a reasonable time within which to respond. 1.33 Request for Payment - The form, in the form of AIA Document G702 (latest ed.) or other published document approved by Owner, which is to be used by the Contractor in requesting progress payments and which is to include a Schedule of Values as required by the Contract Documents and an affidavit of the Contractor that progress payments theretofore received from the Owner on account of the Work have been applied by the Contractor to discharge in full all the Contractor's obligations incurred in connection with Work covered by all prior applications for payment. See paragraph 20.2. 1.34 Resident Superintendent - That person designated by the Contractor in accordance with paragraph 7.2 who has day-to-day responsibility for the prosecution of the Work and the obtaining of proper materials and equipment, and adequate labor and who shall have the authority set forth in the last sentence of paragraph 7.2. 1.35 Schedule of Values - Any breakdown of the Contract Price which may be required by the Contract Documents, and designated as such. See paragraph 20.1. 1.36 Specifications - That portion of the Contract Documents consisting generally of the written requirements for materials, equipment, construction systems, standards, and workmanship for the Work and performance of related services. 1.37 Subcontractor - A person, firm, or corporation who has entered into a direct contract with the Contractor to perform any of the Work at the Project. 1.38 Submittal - Shop drawings, product data, samples, and other documents required by the Contract Documents to be submitted by the Contractor to the Designer. 1.39 Submittal Register - See paragraph 13.2 of these General Conditions. 1.40 Substantial Completion - The point at which the Work, and Work by other Contractors on or in connection with the Project, as determined by the Designer, is sufficiently complete in accordance with the Contract Documents that it can be beneficially occupied by the Owner, and the Work can be utilized by the Owner for its intended use, and all necessary permits and permissions for Beneficial Occupancy and utilization having been obtained by the Contractor. All operations and maintenance manuals, Owner training, and as-built drawings must be submitted prior to Substantial Completion being achieved. 1.41 Sub-subcontractor - A person or entity that has a direct or indirect contract with a Subcontractor to perform any of the Work at the Project. 1.42 Work - The construction and services required by the Contract Documents, including all labor, materials, equipment, and services provided or to be provided by the Contractor to fulfill the Contractor’s obligations. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 7 Revised 07/20 1.43 All references in the Contract Documents to the masculine shall be interpreted as including the feminine or neuter and all references in the Contract Documents to the singular or the plural shall be interpreted as including the other, as may be appropriate in the reasonable interpretation of the Contract Documents. ARTICLE 2. CORRELATION, INTERPRETATION AND INTENT OF CONTRACT DOCUMENTS 2.1 It is the intent of the Specifications and Drawings and other Contract Documents to describe a complete Project in accordance with the Contract Documents. 2.2 The Contract Documents are complementary; what is called for by one is as binding as if called for by all. If the Contractor finds a conflict, error or discrepancy in the Contract Documents, the Contractor shall notify the Designer in writing before proceeding with the Work affected thereby. In resolving such conflicts, errors and discrepancies, the Contract Documents shall be given preference in the following order: Construction Contract, Modifications, Addenda, General Conditions, Specifications, and Drawings. Figure dimensions on Drawings shall govern over scale dimensions, and detailed Drawings shall govern over general Drawings. Any Work that may reasonably be inferred from the Contract Documents as being required to produce the intended result shall be supplied whether or not it is specifically called for. Work, materials or equipment described in words which, so applied, have a well-known technical trade meaning shall be deemed to refer to such meaning and to incorporate any recognized standards which are a part of such meaning if not otherwise defined within the Contract Documents. 2.3 Miscellaneous items, accessories and work which are not specifically mentioned, but which are essential to produce a complete and properly operating installation, or useable structure or plant providing the indicated function shall be furnished and installed without change in the Contract Price. Such miscellaneous items and accessories shall be of the same quality standards, including material, style, finish, strength, class, weight and other applicable characteristics, as specified for the major component of which the miscellaneous item or accessory is an essential part, and shall be approved by the Designer before installation. This requirement is not intended to include major components not covered by or inferable from the Contract Documents. 2.4 The Work of all trades under the Contract Documents shall be coordinated by the Contractor in such a manner as to obtain the best workmanship possible for the entire Project and all components of the Work shall be installed or erected in accordance with the best practices of the particular trade. 2.5 The Contractor shall fully complete the Work and shall be responsible for all of the Work under the Contract Documents to which the Construction Contract applies. If the Contractor is prevented from doing so by any limitation of the Contract Documents, the Contractor shall immediately give notice thereof to the Designer and the Owner in writing. 2.6 Standard specifications or manufacturers' literature, when referenced, shall be of the latest revision or printing unless otherwise stated and is intended to establish the minimum requirements acceptable. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 8 Revised 07/20 2.7 For those materials specified without the use of brand names, the Contractor shall submit within thirty (30) days after his receiving the Construction Contract for signatures, any product that meets the express requirements of the Specifications. Such Submittal shall include manufacturer's data, test reports, performance data and certifications, samples, erection details, and other applicable information as required to permit determination by the Designer whether such proposed products are suitable. The Designer shall be the sole judge as to the suitability of any proposed product. The burden of proof of quality rests with the Contractor. 2.8 The Contractor is required to examine and read the complete set of Contract Documents for information concerning the Work, because some of the Work for which the Contractor will be responsible may be indicated on or in documentation applying primarily to the Work of one or more other separate prime contractors. No allowance will be made for the Contractor’s failure to become familiar with the complete set of project documents. 2.9 Contractor’s requests for clarification or information shall clearly define the cause(s) of Contractor’s request and, as appropriate, shall include Contractor’s interpretation and Contractor’s proposed solution. ARTICLE 3. FAMILIARITY WITH WORK, CONDITIONS AND LAWS 3.1 The Contractor has investigated prior to bidding and is satisfied with all conditions affecting the Work, including but not restricted to those bearing upon transportation, disposal, handling and storage of materials, availability of labor, water, electrical power, roads and uncertainties of weather, or similar physical conditions at the Project site, and the character of equipment and facilities needed prior to and during prosecution of the Work. The Contractor is satisfied as to the character, quality and quantity of surface and subsurface materials or obstacles to be encountered insofar as this information is reasonably ascertainable from inspection of the Project site, including all exploratory work done by the Owner, as well as from information presented by the Contract Documents, or any other information made available to the Contractor prior to receipt of bids. Any failure by the Contractor to become acquainted with the available information shall not relieve the Contractor from the responsibility for estimating properly the difficulty or cost of successfully performing the Work. 3.2 The Contractor shall be entitled to make all inferences from the Contract Documents that would reasonably be made by a contractor having knowledge and experience with similar work; however, the Contractor shall not be entitled to infer from the Contract Documents any fact or condition which would not be inferred by a contractor having knowledge and experience with similar work and the Contractor shall be required to obtain independently such other information as a knowledgeable and experienced contractor would prudently obtain in order to evaluate any such condition. 3.3 The Contractor specifically acknowledges familiarity with all Federal, State, and local laws, ordinances, rules, and regulations which may in any manner affect those engaged or employed in the Work, or the materials or equipment in or about the Work, or in any way affect the conduct of the Work and agrees that the Contractor and the Contractor’s employees, subcontractors, and suppliers will, at all times, comply with same. If the Contractor shall discover any provisions in the Contract Documents which are contrary to or inconsistent with any such law, ordinance, rule, or regulation, the Contractor shall immediately give notice thereof to the Designer and the Owner in writing, identifying any items of Work affected, and the Contractor shall not proceed DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 9 Revised 07/20 until the Contractor has received written direction from the Designer with respect to these items. If the Contractor performs contrary to or inconsistently with any such law, ordinance, rule, or regulation without such written direction, the Contractor shall bear all costs which are a consequence of such performance. 3.4 At times selected by the Designer after execution by the Contractor of the Construction Agreement, a pre-construction conference shall be scheduled and conducted for the benefit of the Project. ARTICLE 4. BONDS 4.1 A performance bond in the full amount of the Contract Price shall be required of the Contractor to guarantee the faithful performance of the Work in compliance with the Contract Documents, in such form as may be required by law and approved by the Owner. The bond shall be dated the same date as the Construction Contract and must be accompanied by a current copy of the power of attorney for the attorney-in-fact executing such bond on behalf of a surety company licensed to do business in the state of North Carolina. 4.2 A payment bond in the full amount of the Contract Price shall be required of the Contractor to guarantee the payment of all labor and material costs or claims in connection with compliance with the Contract. The payment bond shall be in such form as may be required by law and approved by the Owner. Said bond shall be dated and executed in the same manner as the performance bond in paragraph 4.1. ARTICLE 5. INSURANCE AND INDEMNITY 5.1 CONTRACTOR PROVIDED INSURANCE The Contractor shall, without limiting its obligations or liabilities, procure, pay for and maintain such insurance as is required by law and as is required by this Agreement to protect the Contractor and the Owner from claims for damages for bodily injury, including death, and from claims for property damage which may arise from the Contractor's or its representatives', consultants', Subcontractors', agents', or employees' operations under this Agreement. Such insurance shall be of the kinds and have limits of liability and coverages not less than the minimum limits hereinafter specified or required by law, whichever is greater. The Owner makes no representation as to the adequacy or sufficiency of such coverages. The following requirements shall in no way be construed to limit or eliminate the liability of the Contractor, which arises from performance of Work under the Agreement. The Contractor is strictly responsible for any losses, claims, and costs of any kind which exceed the Contractor's limits of liability, or which may be outside the coverage scope of the policies. The insurance specified shall be provided by an insurer approved by the Owner, authorized to do such business in the State of North Carolina, and on terms approved by the Owner. Insurance companies utilized shall have a minimum rating of A- and Class VII as evaluated by the most current A.M. Best Rating Guide. If the insurer has a Best Rating less than A- and Class VII, the Contractor must receive specific written approval from the Owner prior to proceeding with any Work under the Agreement. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 10 Revised 07/20 All agents and brokers shall hold valid licenses from the State of North Carolina. Before commencing mobilization to the Project site and not later than 7 days after the receipt of the Construction Contract by the Contractor for signatures, the Contractor shall furnish to the Owner a certificate or certificates of insurance in a form satisfactory to the Owner. Upon request of the Owner, the Contractor shall provide the Owner with certified copies of the insurance policies required by this Article, including without limitation declaration pages, conditions, exclusions and endorsements, and confirmation that each policy premium has been paid for the required term of this Agreement. A copy of the umbrella policy shall be provided to the Orange County Risk Manager. Certificates shall be signed by a person authorized by that insurer to bind coverage on its behalf. All insurance policies shall provide, as evidenced by Certificates of Insurance, that the insurance shall not be canceled, reduced, restricted, or changed in any way without at least 30 days prior written notice to the Owner. With regard to expiration, cancellation, reduction, restriction, or any other change, certificates shall state: "Should any of the following described policies be canceled before expiration date or be due to expire within 30 days, the insurer shall mail 30 days prior written notice to named certificate holder." In the event of any such cancellation, non-renewal, reduction, restriction, or change in any insurance, the Contractor is obligated to replace such insurance within 7 days without a gap in coverage and file accordingly such notice with the Owner, and other interested parties. Failing immediate receipt of evidence of such replacement of insurance the Owner reserves the right to procure such insurance as the Owner considers desirable and the Contractor shall pay or reimburse the cost of the premium in respect thereof. It is expressly provided, however, that any action or inaction on the part of the Owner in this respect shall in no way change or reduce the Contractor's responsibilities and liabilities under this Agreement. Self-funded, policy fronting, or other non-risk transfer insurance mechanisms are not acceptable without prior written approval of the Owner. Full disclosure of such a program must be made prior to commencing mobilization to the Project site. Failure to make a full disclosure constitutes a material breach of the Agreement, justifying termination for default. The Contractor shall name the Owner, the Designer, the Designer’s consultants, and the Construction Manager as additional insureds under all its insurance contracts (except workers' compensation) with respect to and including without limitation liability arising out of activities performed by or on behalf of the Contractor, products and completed operations of the Contractor, and automobiles owned, hired, leased, or borrowed by the Contractor. The coverage shall contain no special limitations on the scope of protection afforded to additional insureds. For any claims related to this Project, the Contractor's insurance or self-insurance shall be primary and noncontributory with respect to the Owner’s insurance. Any insurance or self - insurance maintained by the Owner shall be excess and noncontributory with respect to the Contractor's insurance. All policies of insurance shall contain a clause waiving rights of subrogation against the Owner, unless the Owner approves otherwise in writing. Limits of coverage are not to be amended by deductible clauses of any nature without the express written consent of the Owner. The Contractor shall be solely responsible for any deductible assumptions that may exist in any insurance policies required under this Agreement. In addition, the Contractor shall be responsible and shall not be reimbursed for any losses arising from any risk or exposure not insured as required herein, or not covered as a result of a normal policy exclusion or that falls DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 11 Revised 07/20 within the self-insured retention, if Contractor self-insured. The Contractor's insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer's liability. The claim provisions in the Contractor’s insurance policies must specifically state the insurance company or Contractor’s Third Party Administrator, if self-insured, has both the right and duty to adjust a claim and provide defense. The policies shall not contain any provision or definition which would serve to exclude or eliminate from coverage third party claims, including exclusions of claims for bodily or other injury to shareholders, partners, officers, directors, or employees of the insured, the premises owner, real estate manager, or the insured's Subcontractor, or any family relative of such persons. If the policies contain any warranty stating that coverage is null and void (or words to that effect) if the Contractor does not comply with the most stringent regulations governing the Work, it shall be modified so that coverage shall be afforded in all cases except for the Contractor's willful or intentional noncompliance with applicable government regulations. Any failure by any person to comply with reporting or other provisions of the policy including breach of warranties, shall not affect coverage provided to the Owner and its representatives, officials, and employees. The insolvency or bankruptcy of the Insured or of the Insured's estate shall not relieve the insurance companies of their obligations under these policies. Any clauses to the contrary are unacceptable and must be stricken. Failure to comply with these requirements shall be a material breach of this Agreement justifying termination for default. 5.1.1 Worker's Compensation and Employers' Liability Insurance The Contractor and its Subcontractors shall procure and maintain Workers' Compensation Insurance in the amount and type required by the State of North Carolina and federal law for all employees employed under the Agreement who may come within the protection of Workers' Compensation Laws and covering all operations under the Agreement whether performed by the Contractor or by his Subcontractors. In jurisdictions not providing complete Workers' Compensation protection, the Contractor and his Subcontractors shall maintain employers' liability insurance in an amount, form, company, and agency satisfactory to the State of North Carolina and the Owner for the benefit of all employees not protected by Workers' Compensation Laws and covering all operations under the Agreement whether performed by the Contractor or by his Subcontractors. The Contractor shall pay such assessments as will protect the Contractor and the Owner from claims under the Workers' Compensation Laws, workers' or workmen's compensation disability benefits, and other similar employee benefit acts. The current Experience Modification Factor shall be indicated on the Certificate of Insurance. Coverage under this section shall be as required by federal and state Workers' Compensation and Occupational Disease Statutes, and shall have minimum limits as follows: Coverage A: Statutory, State of North Carolina Employers' Liability: Each Accident $1,000,000 Disease - Policy Limit $1,000,000 Disease - Each Employee $1,000,000 Such insurance shall include Voluntary Compensation coverage, a Waiver of Subrogation in favor of the Owner as well as other endorsements that may be required by applicable jurisdictions. 5.1.2 Automobile Liability Insurance DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 12 Revised 07/20 The Contractor shall procure and maintain automobile insurance against liability for bodily injury and property damage as described below, that may arise with respect to the Work being performed under the Agreement, and as will provide protection from claims which may arise out of or result from the Contractor's performance of the Work and the Contractor's other obligations under the Agreement, whether such performance of the Work is by the Contractor, by any representative or Subcontractor, by anyone, both officially and personally, directly or indirectly employed by any of them, or by anyone for whose acts any of them may be liable. This policy of insurance shall carry the following minimum Limit of Liability: Combined Single Limit $1,000,000 per occurrence; Aggregate $2,000,000.00. The policy of insurance shall contain or be endorsed to include the following: a) owned, hired, and non-owned automobile liability. b) If the policy contains a warranty stating that coverage is null and void (or words to that effect) if the transporter does not comply with the most stringent regulations governing the Work, it shall be modified so that coverage shall be afforded in all cases except for the transporter's willful or intentional noncompliance with applicable government regulations. Any failure by any party to comply with reporting or other provisions of the policy including breach of warranties, shall not affect coverage provided to the Owner and its representatives, officials, and employees. No subcontracting of waste hauling shall be permitted without prior, written approval of the Owner. 5.1.3 General Liability This policy must be written on an Occurrence basis, with the following minimum Limits of Liability: General Aggregate per project $2,000,000.00 Products/Completed Operations Aggregate $2,000,000.00 Bodily Injury and Property Damage csl/each occurrence $1,000,000.00 Personal Injury and Advertising Injury $2,000,000.00 The policy of insurance shall contain or be endorsed to include the following: a) Blanket Contractual Liability covering Contractor’s indemnification obligations under this Agreement, in accordance with ISO policy form CG 00 01. Modifications to the standard provision will not be acceptable if they serve to reduce coverage. b) Premises/Operations Liability. c) Explosion, collapse, and underground fault. d) Independent Contractors and Independent Subcontractors coverage. e) Broad Form Property Damage. f) Personal Injury g) Cross Liability/Severability of Interest clause. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 13 Revised 07/20 h) Employer’s Stop-Gap Liability endorsement, if applicable. i) Amendment of the Pollution Exclusion Endorsement to allow coverage for bodily injury or property damage caused by heat, smoke, or fumes from a hostile fire. j) Designated General Aggregate Limit Endorsement if required by the Contract Documents. Coverage shall remain continuously in effect and without interruption for at least 6 years from the date of the Notice of Award and shall include coverage for exposures arising from operations that have been completed. The Contractor shall furnish the Owner and each other additional insured listed in the Agreement to whom the Certificates have been issued, evidence satisfactory to the Owner of continuation of such insurance at the date of Preliminary Acceptance and each year thereafter. 5.1.4 Pollution Legal Liability (PLL) Pollution Legal Liability coverage will be provided as follows: $1,000,000.00 per occurrence; Aggregate $2,000,000.00. 5.1.5 Umbrella Liability The Contractor shall maintain an occurrence basis (as distinguished from a “claims made” basis) Umbrella Liability policy (true follow form) over the underlying General Liability, Automobile Liability, and Employer's Liability, with the following limits of liability: Each Occurrence $3,000,000, Aggregate $3,000,000. On a fully insured basis such coverage will be subject to a deductible no greater than $10,000 per occurrence where coverage is not provided by the underlying insurance, but is provided by the Umbrella Liability policy. The Contractor may use any combination of primary and umbrella insurance policies to comply with the insurance requirements, provided the resulting insurance is equivalent to the insurance stated herein. All Occupational Disease exclusions must be deleted. Any Pollution Exclusion must be amended to allow coverage for bodily injury or property damage caused by spill, upset, overturn, heat, smoke, or fumes from a hostile fire. 5.1.6 Property Insurance The Contractor shall purchase All Risk Property Insurance on a Completed Value Form in the names of the Owner, Contractor, Subcontractors, and sub-subcontractors as their interests may appear with limits as follows: a) Full insurance value of the Work, or b) Amount equal to the Contract Price for the Work, whichever is higher. The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor or Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 14 Revised 07/20 or control, and all such property while it is in transit. The insurance coverage evidencing such shall include a waiver of subrogation in favor of the Owner. 5.1.7 Valuable Papers and Records The Contractor shall provide valuable papers and records insurance with coverage in an amount commensurate with project scope and set forth in the Supplementary General Conditions. 5.1.8 Claims The Contractor shall notify the Owner within 24 hours of any claims or alleged claims received by the Contractor covered by any of the policies of insurance required in this Agreement. The Contractor shall provide a written copy of the claim or alleged claim to the Owner within 3 days of the Contractor's receipt of the claim or alleged claim. If a claim is settled to the satisfaction of the claimant, the Contractor shall submit a copy of the claimant's release to the Owner. If a claim or alleged claim is rejected by the Contractor or its insurance company, the Contractor shall immediately report this fact to the Owner. Should 30 days elapse after the claim or alleged claim has been received by the Contractor, and the Contractor is not able to report a settlement or rejection of the claim, it shall report to the Owner the steps being taken with respect to the claim. Without limiting the foregoing, the Contractor shall notify in writing the county risk manager of any paid or incurred claims which may impair annual aggregate or general liability. 5.1.9 Deductibles and Self-insured Retentions Any deductibles or self-insured retentions must be declared to and approved by the Owner. At the option of the Owner, either: a) the insurer shall reduce to a maximum of $250,000 or eliminate such deductibles or self-insured retentions with respect to the Owner, or (b) the Contractor shall provide evidence of collateral provided to insurers or procure a bond guaranteeing payment of losses and related investigations, claim administration, and defense expenses within the deductible or self-insured retention amount. Any self-insured retention or deductible amount on the policy shall not reduce the amount of collectible limits or liability. 5.1.10 Subcontractors The Contractor shall include all Subcontractors as Insureds under its policies, or shall furnish separate certificates, policies, and endorsements for each Subcontractor the Contractor intends to use. If a Subcontractor does not take out insurance in his own name and the Contractor wishes to provide insurance protection for such Subcontractor and such Subcontractor's employees, the Contractor shall either (a) procure appropriate policies in the name of the Subcontractor, or (b) cause a rider or riders to be attached to the Contractor's policies which shall identify the Subcontractor thereby covered; provided, however, in the case of the latter option, such a rider need not be attached to the Contractor's workers' compensation policy if such policy by its terms is sufficiently broad to cover the employees of all Subcontractors performing Work under the Contract Documents. Except as otherwise approved by the Owner in writing, Limits of Liability and coverage scope must be at a minimum as stringent as required of the Contractor by the Contract Documents. All Work performed for the Contractor by any Subcontractor shall be pursuant to an appropriate agreement between the Contractor and the Subcontractor which shall contain provisions that waive all rights the contracting parties may have against one another for damages caused by fire or other perils covered by insurance as DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 15 Revised 07/20 provided herein. Insurance monies received from any loss shall be divided as the respective interest of the parties affected shall appear. 5.2 OWNER CONTROLLED PROJECT SPECIFIC INSURANCE In the event the Owner elects to purchase project-specific insurance affording coverage to the Contractor and Subcontractors, the terms and conditions of such coverage shall be set forth in the Supplementary Conditions. 5.3 CONTRACTOR AS JOINT VENTURE If the Contractor is completing this Project on a joint venture basis, both joint venture partners retain all liabilities assumed by this Agreement, individually and collectively. This may include, but is not limited to, all premiums due, deductibles/self-insured retentions, coinsurance provisions, claim provisions, insurance policy conditions, and indemnification provisions hereunder. Evidence of a Blanket Joint Venture Endorsement must be obtained from the General Liability and Contractor's Pollution Legal Liability carriers of each joint venture partner for a period of 6 years after completion of the Project, substantially as follows: With respect to "your work", and the "products-completed operations hazard", you are an insured for your liability arising out of the conduct of any partnership or joint venture of which you were a partner or member, even though this partnership or joint venture is not shown as a Named Insured in the Declarations. This coverage is excess over any available liability purchased specifically to insure the partnership or joint venture. This coverage will not inure to the benefit of any other party except you." 5.4 INDEMNIFICATION The Contractor, to the fullest extent not expressly prohibited by law, shall defend, indemnify, and save harmless the Owner, the Designer, the Construction Manager and their respective officials, officers, employees, and agents from and against any and all liabilities (foreseeable or unforeseeable), penalties, fines, liens, forfeitures, demands, claims, causes of actions, suits, judgments, and costs and expenses incidental thereto, (including, without limitation, amounts paid pursuant to investigations, defense or settlements, and reasonable attorneys' fees), which any or all of them may hereafter suffer, incur, be responsible for, or pay out as a result of but not limited to: a) bodily injury (including sickness, disease, or death) to any person including but not limited to, the Contractor's employees or its representatives while on the site of the Project; or b) actual or alleged damage (including loss of use) to any property (public or private, including the Project or other property on the Project site); or c) contamination of or adverse effects on the environment arising directly or indirectly out of or in connection with the performance of the Work, including but not limited to any hazardous or toxic waste, substance, or constituent of any substance subject to regulation under CERCLA, RCRA, TSCA, and other Federal and state authorities that is spilled, released, threatening to release, or disposed of or destroyed by the Contractor or its Subcontractors on or off the site of the Project or while in transport to or from the site; or DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 16 Revised 07/20 d) any violation or alleged violation of laws and regulations, arising out of or in any way connected with the Work, caused in whole or in part by the Contractor, any Subcontractor or supplier or any representatives of the Contractor. The Contractor shall not be required to indemnify the Owner against losses resulting from a breach of this Agreement by the Owner or its other agents and contractors, or resulting from negligence, misconduct or violation of laws on the part of the Owner or its other agents and contractors. e) upon completion of the Work the Contractor shall execute an affidavit, indemnification, and release stating there are no unpaid debts for any work that has been done or materials that have been furnished to the Project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, liens, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such claims, liabilities, liens, losses, damages, causes of action, or expenses. Such affidavit, indemnification, and release shall be in a form and substance acceptable to Owner. By executing this Agreement Contractor acknowledges the receipt of adequate consideration in return for said release. The Contractor further agrees to obtain, maintain, and pay for such liability insurance coverages and endorsements as will insure the provisions of this paragraph 5.4. Furthermore, the Contractor agrees to be liable for and to indemnify and reimburse the Owner for all legal fees and disbursements paid or incurred to enforce the provisions of this paragraph. The indemnification obligations under this paragraph shall not be limited in any way by the amount or type of damages, compensation or benefits payable under worker's compensation acts, disability benefit acts, other employment benefit acts, or the amount of insurance carried or recovered. The Owner acknowledges that hazardous or toxic waste, material, chemicals, compounds or substances, or other environmental hazards, contamination or pollution, (referred to hereinafter as “environmental hazards”) may be present at the Project site that were not created, generated, or released at the Project site by the Contractor or its Subcontractors, agents or employees, acting alone or in concert with others. Unless the remediation, abatement or handling of such environmental hazards is part of the scope of the Work under this Agreement, then upon the discovery of such environmental hazards, the Contractor shall immediately, and in no event more than three days later, give notice to the Owner of the environmental hazards before they are disturbed. The Owner and the Designer shall thereupon promptly investigate the environmental hazards, and make such changes in the Drawings and Specifications as they may find necessary to abate, remediate, isolate or handle the environmental hazards. Any increase or decrease in the Contract Price or the Contract Time resulting from such changes shall be adjusted in the manner provided herein for adjustments as to extra or additional Work and changes. It is agreed that the Contractor shall have no liability under this Agreement for any environmental hazards existing prior to the date that Work commences under this Agreement unless the Contractor or its Subcontractors, agents or employees, acting alone or in concert with others, by their own negligence or misconduct, release or expose the Owner or third parties to the environmental hazards. The provisions of this paragraph shall survive the termination or cancellation or completion of this Agreement. 5.5 RISK MANAGEMENT POLICY DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 17 Revised 07/20 The Orange County Risk Management Policy shall not apply to construction contracts for amounts over $250,000. The terms of these General Conditions related to insurance shall be the sole authority governing insurance requirements for such contracts. ARTICLE 6. OTHER RECORD DOCUMENTS AND SUBMITTALS 6.1 The Designer shall furnish to the Contractor the number of copies of Drawings and Specifications stated in the Contract Documents. Additional copies of Drawings and Specifications may be obtained at the cost of reproduction and handling. 6.2 The Contractor shall submit to the Designer all Submittals required by the Contract Documents. The Contractor shall submit at least three (3) reproducible prints of all shop drawings. The Contractor shall submit samples in quantities required by the Contract Documents. The Contractor shall submit product data in at least five (5) copies. All shop drawings shall be reviewed by the Contractor and shall bear the Contractor's stamp of approval before being forwarded to the Designer. Submittals shall be submitted in such time as to cause no delay to the Work or any part thereof and in accordance with the Contract Construction Schedule and Submittal Register. The Designer shall review the submittal with reasonable promptness, noting desired corrections, if any. The Designer shall retain two (2) copies of the submittal and shall return the balance of the reviewed submittal to the Contractor for action. The Contractor shall furnish any corrected submittal to the Designer. The Designer shall retain two (2) copies of the corrected submittal and will return the balance of the reviewed submittal to the Contractor. All substitutions prior to the receipt of bids shall be in accordance with the Contract Documents. Refer to Instructions to Bidders, Substitutions. The Contractor acknowledges that the processing of shop drawings and other submittals is directly impacted by the clarity, completeness, and accuracy of said documents and that it is the Contractor’s responsibility to (i) review and coordinate each submittal with all other related or affected Work and (ii) approve each submittal before submitting same to the Designer for approval. 6.3 No substitutions and no deviations from any requirement of the Contract Documents shall be deemed allowed unless the Contractor has specifically informed the Designer and the Owner in writing of such deviations at the time of submittal and the Designer and the Owner have given written and specific approval to the substitutions or deviations. In proposing a deviation or substitution the Contractor warrants to the Owner, notwithstanding any review, allowance or approval by the Designer or the Owner that the deviation or substitution is at least equal to or better in quality and for the purpose intended, and that Contractor shall not by reason of any such review, allowance or approval be relieved from any obligation or responsibility contained in the Contract Documents. 6.4 Review of submittal by the Designer shall not be construed as relieving the Contractor from responsibility for compliance with terms or designs of the Contract Documents nor from responsibility for errors of any sort in the submittal. 6.5 The Contractor shall keep one record copy marked "As-Built" of all Specifications, Drawings, Addenda, Modifications, and Submittals at the Project in good order and annotated at least monthly to show all changes made during the construction process. Such monthly annotations DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 18 Revised 07/20 and their approval by the Designer shall be a condition precedent to approval by the Designer of each monthly Request for Payment. Said record copy shall be stored at the Project and fully protected from damage by fire or other hazard. This record copy shall be available to the Designer and Owner for inspection at all times and shall be delivered to the Designer for the Owner's purposes prior to the Designer's certifying Substantial Completion of the Work. 6.6 At completion of the Project and before Final Payment, the Contractor shall assemble and deliver to the Owner one complete set of all as-built drawings and one complete set of all approved submittals, product data, and samples which were reviewed by the Designer. These drawings and submittals shall be on paper, or in electronic or other media if required by the Supplementary Conditions. These drawings and submittals shall be categorized and packaged as directed by the Designer. ARTICLE 7. CONTRACTOR 7.1 The Contractor shall supervise and direct the Work efficiently and with the Contractor’s best skill and attention. Except as may be set forth specifically in the Contract Documents, the Contractor shall be solely responsible for the means, methods, techniques, sequences, and procedures of construction, and for safety precautions and programs in connection with the Work. The Contractor shall be responsible to see that the finished Work complies accurately with the Contract Documents. 7.2 The Contractor shall appoint a Project Manager and shall keep on the Project at all times during its progress a competent Resident Superintendent and necessary assistants who shall not be replaced without prior written approval by the Owner except under extraordinary circumstances, in which event immediate written notice shall be given to the Designer and the Owner. The Project Manager and the Resident Superintendent may be the same person or different persons. At any time, the Owner, in its sole and absolute discretion, may require the Contractor to replace the Project Manager or Resident Superintendent with an experienced and competent person or persons upon seven (7) days written notice from the Owner to the Contractor. Such replacement shall be at the Contractor's expense and at no cost to the Owner. Both the Project Manager and the Resident Superintendent shall have authority to act on behalf of the Contractor, and instructions, directions or notices given to either of them shall be as binding as if given to the Contractor. 7.3 The Contractor shall provide sufficient competent and suitably qualified personnel, equipment, and supplies to lay out the Work and perform construction as required by the Contract Documents. The Contractor will at all times maintain good discipline and order at the site, and will comply with all applicable OSHA standards. Any person employed by the Contractor, any Subcontractor, or any sub-subcontractor who, in the opinion of the Designer or the Owner, does not perform his Work in a proper and skillful manner or is intemperate or disorderly shall, at the written request of the Owner or Designer, be removed forthwith by the Contractor, Subcontractor, or sub-subcontractor employing such person without cost to the Owner, and shall not be employed again in any portion of the Work without the written approval of the Owner or Designer. Should the Contractor fail to remove such person or persons or fail to furnish suitable and sufficient personnel for the proper prosecution of the Work within three (3) days after written DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 19 Revised 07/20 order, the Owner may withhold further payment by written notice until compliance with such order. 7.4 If, in the opinion of the Designer or the Owner, any Subcontractor on the Project is incompetent or otherwise unsatisfactory, he shall be replaced by the Contractor with no increase in the Contract Price if and when directed by the Designer or the Owner in writing. 7.5 The Contractor shall furnish all materials, equipment, labor, transportation, construction equipment and machinery, tools appliances, fuel, light, heat, and all other facilities and incidentals necessary for the execution, maintenance, initial operation, and completion of the Work, other than those specifically excluded by the Contract Documents and to be furnished by the Owner or others. When use or storage of hazardous materials or equipment or methods of more than ordinary risk are necessary in accomplishing the Work, the Contractor shall give the Owner and Designer reasonable advance notice. If any materials are to be furnished or installed by the Owner or others under the terms of the Contract Documents, said materials shall be made available to the Contractor at the location(s) specified in the Contract Documents. All costs of handling, transportation from the specified location to the Project, storage, and installing of Owner-furnished materials shall be included in the Contract Price. The Contractor shall be responsible for any demurrage, damage, loss, or other deficiencies which may occur during the Contractor's handling, storage, or use of such Owner-furnished material. The Owner shall deduct from any monies due or to become due the Contractor any cost incurred by the Owner in making good any such damage, loss, or efficiency. All equipment which is proposed to be used in the Work shall be of sufficient size and in such mechanical condition as to meet the requirements of the Work and produce a satisfactory quality of work. Equipment used on any portion of the Work shall be such that no injury to previously completed Work, adjacent property, or existing facilities shall result from its use. When the methods and equipment to be used by the Contractor accomplishing the Work are not prescribed in the Contract Documents, the Contractor shall be free to use any methods or equipment that will accomplish the Work in conformity with the requirements of the Contract Documents. When the Contract Documents specify the use of certain methods and equipment, such methods and equipment shall be used unless others are authorized by the Designer. If the Contractor desires to use a method or type of equipment other than specified in the Contract Documents, the Contractor may request authority from the Designer to do so. The request shall be in writing and shall include a full description of the methods and equipment proposed and of the reasons for desiring to make the change. If approval is given, it shall be on the condition that the Contractor shall be fully responsible for producing Work in conformity with the requirements of the Contract Documents. If, after trial use of the substituted methods or equipment, the Designer determines that the Work produced does not meet the requirements of the Contract Documents, the Contractor shall discontinue the use of the substitute method or equipment and shall complete the remaining Work with the specified methods and equipment at no additional cost to the Owner. The Contractor shall remove any deficient Work and replace it with Work of specified quality, or take such other corrective action as the Designer may direct. No change in the Contract Price or in Contract Time shall be made as a result of authorizing a change in methods or equipment under this paragraph. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 20 Revised 07/20 7.6 All materials and equipment shall be new, except as otherwise provided in the Contract Documents. When special makes or grades of material which are normally packaged by the supplier or manufacturer are specified or approved, such materials shall be delivered to the Project site in their original packages or containers with seals unbroken and labels intact. Materials shall be so stored as to assure the preservation of their quantity, quality and fitness for the Work. Stored materials, even though approved before storage, may again be inspected by the Designer or Owner prior to their use in the Work and shall meet the requirements of the Contract Documents at the time they are incorporated into the Work. Stored materials shall be located so as to facilitate their prompt inspection. The Contractor shall coordinate the storage of all materials with the Designer and the Owner. Materials to be stored at the Project or on the Owner's property shall not create an obstruction to the Owner's or other contractor's reasonable activities. Private property shall not be used for storage purposes without written permission of the owner or lessee of such property. The Contractor shall make all arrangements and bear all expenses for the storage of materials on private property. Upon request, the Contractor shall furnish the Owner a copy of the property owner's permission. All storage sites on private or the Owner's property shall be restored to their original condition by the Contractor at his entire expense, except as otherwise agreed to (in writing) by the owner or lessee of the property. 7.7 All materials and equipment shall be applied, installed, connected, erected, used, cleaned and conditioned in accordance with the instructions of the applicable manufacturer, fabricator, or processor, except as otherwise provided in the Contract Documents. 7.8 The Contractor will be fully responsible for all acts and omissions of his Subcontractors and of persons directly or indirectly employed by them and of persons for whose acts any of them may be liable to the same extent that the Contractor is responsible for the acts and omissions of the Contractor’s own employees. Nothing in the Contract Documents shall create any contractual relationship between any Subcontractor or supplier and the Owner or the Designer, or any obligation on the part of the Owner or the Designer to pay or see to the payment of any money due any such Subcontractor or material furnisher except as may otherwise be required by law. The Owner or the Designer may furnish to any Subcontractor or supplier, to the extent practicable, evidence of amounts paid to the Contractor on account of specific Work done. 7.9 The divisions and sections of the Specifications and the identifications of any Drawings shall not control the Contractor in dividing the Work among Subcontractors. 7.10 The Contractor agrees to bind specifically every Subcontractor to the terms and conditions of the Contract Documents for the benefit of the Owner and to furnish written evidence thereof to the Designer and the Owner within seven (7) days after written request by the Owner. 7.11 The Contractor shall attend job progress conferences and all other meetings or conferences as directed by the Designer. The Contractor shall be represented at these job progress conferences by a representative having the authority of the Project Manager and by such other representatives as the Designer may direct. Job progress conferences shall be open to Subcontractors, suppliers and any others who may contribute beneficially toward maintaining required job progress, and such personnel shall be encouraged by the Contractor to attend. It shall be the principal purpose of job progress conferences to effect coordination, cooperation and assistance in every practical way toward the end of maintaining progress of the Project on DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 21 Revised 07/20 schedule and to complete the Work and the Project by the specified Completion Dates. The Contractor shall be prepared to assess progress of the Work as required in the Contract Documents and to recommend remedial measures for correction of progress as may be appropriate. The Designer shall preside as chairman and arrange for minutes to be taken and circulated. In the event that the prosecution of the Work is discontinued for any reason, the Contractor shall notify the Designer and the Owner at least forty-eight (48) hours in advance of resuming operations. Should the terms of the Contract Documents require completion of one or more portions of the Work for the Beneficial Occupancy of the Owner prior to completion of the entire Work, the Contractor shall complete such portion(s) of the Work on or before the date specified. Such completion shall include the obtaining of all government or other permits, permissions, and approvals necessary to occupancy. The Contractor shall independently estimate the difficulties involved in arranging the Work to permit such Beneficial Occupancy and shall not claim any additional compensation or time extension by reason of any delay or increased cost due to completing such portion(s) of the Work. The Owner's possession and use of such portion(s) of the Work shall not be deemed an acceptance of any Work not completed in accordance with the Contract Documents. The Owner shall be responsible for the security, maintenance, utilities, and insurance of all portions of the Work completed and beneficially occupied by the Owner. 7.12 The Contractor shall pay all license fees and royalties, and assume all costs incident to the use of any invention, design process, or device which is the subject of patent rights or copyrights held by others, except for inventions, design processes, or devices specified by the Designer in the Contract Documents. The Contractor shall indemnify and hold harmless the Owner, the Designer, and anyone directly employed by either of them, from and against all claims, damages, losses and expenses, including attorney's fees and costs of defense, arising out of any infringement or alleged infringement of such rights during or after completion of the Work, and shall defend all such claims in connection with any actual or alleged infringement of such rights. 7.13 The Contractor shall secure and pay for all permits, including without limitation construction permits and licenses, and will pay all governmental charges and inspection fees necessary for the prosecution of the Work. 7.14 The Contractor shall give all notices and comply with all laws, ordinances, rules, and regulations applicable to the Work and shall protect and indemnify the Owner and the Owner’s officers, agents, or servants against any claim or liability arising from or based on the violation of any such law, ordinance, regulation, order, or decree, whether by the Contractor or by the Contractor’s employees, Subcontractors, sub-subcontractors, or their employees. 7.15 The Contractor shall be responsible for the entire site of the Project (except those under the Beneficial Occupancy of the Owner) and for its reasonable and necessary protection and security, as required by laws or ordinances governing such conditions, or by custom or sound construction practices, and shall share such responsibilities as may be agreed upon among them, or in the absence of such agreement, as may be directed by the Contract Documents, Owner, or Designer. The Contractor shall be responsible for any damage to the Owner's property, or that of others, by the Contractor or the Contractor’s employees, Subcontractors, DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 22 Revised 07/20 sub-subcontractors, or their employees or agents, and shall make good such damages. The Contractor shall be responsible for and pay for any such claims against the Owner. 7.16 The Contractor shall protect all landscaping designated to remain in the vicinity of the operations and barricade all walks, roads, and areas as necessary to keep the public away from the construction. 7.17 The Contractor shall provide cover and protect all portions of the Work and provide all materials necessary to protect the Work whether performed by the Contractor or any of the Subcontractors or sub-subcontractors. Any Work damaged through the lack of proper protection, or from any other cause, shall be repaired or replaced without extra cost to the Owner or extension to the Contract Time. The Contractor shall maintain the Work during construction and until the Work is accepted. This maintenance shall constitute continuous and effective effort prosecuted day by day, with adequate equipment and forces so that the Work is maintained in satisfactory condition at all times. All costs of maintenance shall be included in the Contract Price and the Contractor will not be paid an additional amount for such effort. Should the Owner or Designer observe that the Contractor at any time has failed to maintain the Work as provided herein, the Designer may immediately notify the Contractor of such noncompliance. Such notification shall specify a reasonable time within which the Contractor shall be required to remedy such unsatisfactory maintenance condition. Should the Contractor fail to properly respond to the Designer's notification, the Owner may, at the Contractor's expense, take such action as it may deem appropriate to remedy the defective maintenance, including suspension of the Contractor's Work or any part thereof. Any such expense incurred by the Owner shall be deducted from monies due or to become due the Contractor. Parking lots, streets, and walks connecting to the Project area shall be protected by the Contractor from deposits of mud, sand, stone, litter, or debris in any form. Pedestrian traffic areas around the construction limits must be maintained in a clean and safe condition at all times with required barricades and covered walkways. When excavation or other operations outside the Project limits is required, the Contractor shall, immediately following that work, return the area to its original condition. All catch basins and storm drain lines in the vicinity of the Project site shall be protected at all times from entry of dirt, rubble and other debris. The residue from the cleaning of trucks, wheelbarrows, concrete buggies, etc. must be prevented from entering the drainage system, and if cleaning is done, the residue must be contained and removed from the Project site with other refuse. 7.18 No burning of refuse or debris shall be allowed inside or around the Project during the course of construction without written authority from authorities having jurisdiction and the Owner. 7.19 The Contractor shall provide for and maintain necessary safety measures and safety programs for the protection of all persons involved with the Work. Such measures and programs shall include the requirements of the most current edition of the CAGC Safety and Health Manual [or the AGC Accident Prevention Manual in Construction], or equivalent requirements, and shall fully comply with all Federal, State, and local laws, rules, regulations, and building DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 23 Revised 07/20 code requirements relating to the prevention of accidents or injuries to persons on or about the location of the Work. All trenches, excavations, or other hazards in the vicinity of the Work shall be well barricaded, and properly lighted at night. When Work requires closing of an area normally used by the Owner or the public, the Contractor shall furnish, erect, and maintain temporary barricades, and properly light the area. The Contractor shall comply with any directions and public authorities in this respect. 7.20 The Contractor shall designate a responsible officer or employee as safety inspector, whose duties shall include accident prevention on the Project as well as implementation of the Contractor’s safety measures and safety programs on the Project. The name of the safety inspector shall be made known to the Designer and the Owner at the preconstruction conference. 7.21 In emergencies affecting the safety of persons, the Work, or property at the Project site or adjacent thereto, the Contractor is obligated to act in the Contractor’s discretion to prevent threatened damage, injury, or loss. As soon as practicable, the Contractor shall notify the Designer and Owner of such emergency. The Contractor shall give the Designer and the Owner prompt written notice of any significant changes in the Work or deviations from the Contract Documents caused by such emergency. If the Contractor believes that additional work done in an emergency entitles the Contractor to an increase in the Contract Price or an extension of the Contract Time, the Contractor may make a claim therefore as provided in Articles 14 or 15. 7.22 The Contractor shall at all times keep the premises free from accumulation of waste materials or rubbish caused by the Work. At least weekly and at the completion of the Work, the Contractor shall remove all waste materials and rubbish from and about the Project. At the completion of the Work, the Contractor shall remove all tools, construction equipment, machinery, and surplus materials. The Contractor shall leave the Work in condition for occupancy by the Owner such that no cleaning or other operations are required. Material cleared from the Project and deposited on adjacent property shall not be considered as having been disposed of satisfactorily. If the Contractor fails to keep the Project clean of waste materials or rubbish, fails to satisfactorily clean-up weekly or at the completion of the Work, the Owner may do so and the costs thereof may be deducted from any amounts due the Contractor. 7.23 Utilities, temporary facilities, and signs shall be provided as described in the Contract Documents. Absent a contrary direction in the Supplementary Conditions, the Contractor shall pay all bills for water, electricity, or other public utility service to the Project site. 7.24 The Contractor shall indemnify and hold the Owner, the Designer, the Designer's consultants, and their officers, agents, and employees harmless against all costs, damages, and expenses, including attorney's fees and costs of defense, arising out of claims by any separate contractor or by any Subcontractor, sub-subcontractor, or supplier engaged by or employed by the Contractor or employed by any of the Subcontractors claiming through him, including without limitation damages, losses, and expenses arising out of or relating to any inconvenience, delay, interference, or other action or non-action of the Contractor or the Contractor’s Subcontractors on the Project. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 24 Revised 07/20 The Contractor acknowledges that should the Contractor or any of the Contractor’s Subcontractors be damaged by any breach of contract by any other separate prime contractor on the Project, the Contractor may invoke applicable dispute resolution procedures with said other separate prime contractor or bring a direct civil action against said other separate prime contractor. The Contractor hereby expressly agrees that neither the Owner nor its officers, agents, or employees shall have any liability of any kind or nature whatsoever to the Contractor, its Subcontractors, sub-subcontractors, or suppliers arising out of or relating to any breach, inconvenience, delay, interference, or other action or non-action by any other separate prime contractor. The Contractor covenants not to sue the Owner for any loss or damage caused by any breach, inconvenience, delay, interference, or other action or non-action by any other separate prime contractor, notwithstanding whatever rights at law the Contractor might have to bring a civil action against the Owner for any breach, inconvenience, delay, interference, or other action or non-action of any other separate prime contractor. The Contractor agrees to look exclusively to the other prime contractor for relief or remedy. Nothing contained herein or appearing anywhere in the Contract Documents shall obligate or require the Owner to exercise any right or privilege, or to take any action or to refrain from taking any action under any contract it may have with any other prime contractor or party to the Project for the benefit of the Contractor or any Subcontractor, subSubcontractor, or supplier claiming through the Contractor. 7.25 Prior to completion of the Work and Final Payment of the Contract Price, excepting only those portions of the Work deemed accepted in accordance with the Contract Documents, the Contractor shall have charge and care of the Work, and shall take every precaution against injury or damage to any part due to the action of the elements or from any other cause, whether arising from the execution or from the non-execution of the Work. The Contractor shall as required by the Owner replace, rebuild, repair, restore, and make good all injury or damage to any portion of the Work occasioned by any of the above causes before Final Completion and shall bear the expenses thereof. 7.26 In the event that the Work, or any portion thereof, is suspended at any time pursuant to an order of the Owner, the Contractor shall obey all instructions of the Owner regarding storage of materials, drainage, protection of the Work, and erection of temporary structures during the suspension period. 7.27 The Project Expediter for the Project shall be responsible for the coordination of the Work of itself and any other separate contractors, both as to space and time. The Project Expediter shall coordinate the implementation of the Contract Construction Schedule, all construction activities and close-out of the Project, including but not limited to all testing, inspection, certifications, and approvals required by public agencies. The Contractor and the Project Expediter shall each be required to notify the Designer and the Owner promptly of any event or condition which could affect the conduct or progress of the Work and shall cooperate fully with all other contractors on the Project site. 7.28 The Owner hereby delegates to the Project Expediter all of its duties to coordinate and to expedite the Work not expressly reserved to the Owner by other provisions of the Contract Documents. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 25 Revised 07/20 7.29 All Work performed pursuant to the Contract Documents shall conform in all respects to the North Carolina State Building Code and all other state, local, and national codes in effect at the time of and applicable to this Work. 7.30 The Contractor shall provide for and maintain necessary safety measures and safety programs for the protection of all persons at the Project site, and shall comply at all times with the requirements of the most current edition of the CAGC Safety and Health Manual [or the AGC Accident Prevention Manual in Construction], or the equivalent requirements of the Contractor’s safety program, and shall fully comply with all Federal, State, and local laws, rules, regulations, and building code requirements so as to prevent accidents or injuries to persons on or about the Project site. The Contractor shall clearly mark or post signs warning of existing hazards, and shall barricade excavations, elevator shafts, stairways, and similar hazards. The Contractor shall protect against damage or injury resulting from falling materials, and shall maintain all protective devices and signs throughout the progress of the Work. 7.31 The Contractor shall adhere to the rules, regulations, and interpretations of the North Carolina Department of Labor’s Occupational Safety and Health Standards for the Construction Industry (29 CFR Part 1926 as adopted in 13 NCAC 07F.0201, including 29 CFR Part 1910 General Industry Safety and Health Standards applicable to construction) and N.C. Gen. Stat. §95-126 through 155 (Occupational Safety and Health) as well as all revisions and amendments to such standards or statutes as may occur throughout the performance of the Work. 7.32 Any land disturbing activity performed by the Contractor in connection with the Project shall comply with all erosion control measures set forth in the Contract Documents and any additional measures which may be required in order to ensure that the Project is in full compliance with the Sedimentation Pollution Control Act of 1973, as implemented by Title 15 North Carolina administrative Code, Chapter 4, Sedimentation Control, Subchapters 4A, 4B and 4C, as amended (15 NCAC 4A, 4B, and 4C), and as may be revised or amended in the future. Upon receipt of notice that a land-disturbing activity is in violation of said Act, the Contractor shall be responsible for ensuring that all steps or actions necessary to bring the Project in compliance with said Act are promptly taken. The Contractor shall be responsible for all penalties assessed pursuant to N.C. Gen. Stat. 113A-64 with respect to its Work, and shall indemnify and hold harmless the Owner from all costs and expenses, including attorney's fees and costs of defense arising out of or related to the enforcement of the Act against any party or person described in this Article. 7.33 Any mechanical or electrical work such as sleeves, inserts, chases, etc. located in the Work of the Contractor for general work shall be built in by that Contractor. On multiple prime projects, the mechanical and electrical contractors shall set all sleeves, inserts, and other devices built into the structure in cooperation and under the supervision of the Contractor for general work. The responsibility for exact location of such items shall be that of the mechanical, plumbing, or electrical prime contractor. 7.34 The Contractor shall be responsible for permanently fixed service facilities and systems in use during progress of the Work and shall strictly adhere to the following procedures: a) Prior to acceptance of the Work by the Owner, the Contractor shall remove and replace any part of the permanent building systems damaged through use during construction. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 26 Revised 07/20 b) Temporary filters shall be installed in each of the heating and air conditioning units, return air grilles, and other locations to prevent intrusion of dust, dirt, and debris during construction. Temporary filters shall be removed and replaced with new filters immediately prior to Substantial Completion. c) Extra effort shall be maintained to keep the building clean and under no circumstances shall air systems be operated if finishing operations are creating dust in excess of what would be considered normal if the building were occupied. d) When the permanent lighting system is used during construction, lamps shall be replaced and shall be new on the date of Substantial Completion. ARTICLE 8. OWNER 8.1 The Owner shall issue communications and notices to the Contractor through the Designer to the extent contemplated by the Contract Documents. 8.2 In case of termination of the employment of the Designer, the Owner shall appoint as Designer a qualified person who shall have and assume all rights and duties held by the original Designer. 8.3 The Owner shall have the right to take possession of and use any portion of the Work notwithstanding the fact that the time for completion of such portion of the Work may not have expired, but such taking possession and use shall not be deemed an acceptance of any Work not completed in accordance with the Contract Documents. 8.4 A waiver on the part of the Owner of any breach of any part of the Contractor shall not be held to be a waiver of any other or subsequent breach. 8.5 The Owner shall pay all permanent acreage fees, governmental impact fees, and meter deposits for permanent utilities. ARTICLE 9. CONSTRUCTION MANAGER 9.1 The Owner may employ one or more Construction Managers for the purpose of assisting the Owner, Designer, and Contractor in developing and administering budgets and cost controls, in evaluating constructability and value engineering proposals, in establishing and maintaining a critical path method (CPM) schedule, in coordinating or expediting the Work with other projects being constructed by the Owner or others adjacent or near the Work, or for such other purposes as the Owner may deem appropriate. From time to time the Owner may identify such Construction Managers(s) to the Contractor in writing identifying any tasks assigned to such Construction Managers(s). ARTICLE 10. DESIGNER 10.1 The Designer is charged with the responsibility of interpretation of the Contract Documents. The Designer’s decisions relating to aesthetic matters shall be final. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 27 Revised 07/20 10.2 All Work completed under the Contract Documents shall be subject to review by the Designer. No Work is to be covered without the Designer's review or prior authorization. Any Work so covered without the Designer's review or prior authorization shall be uncovered at the Contractor's expense. The Contractor shall notify the Designer in writing at least twenty-four (24) hours in advance of covering any Work. 10.3 The Designer shall not be responsible for the construction means, methods, techniques, sequences, procedures, or the safety precautions and programs incident thereto, and shall not be responsible for the Contractor's failure to perform the Work in accordance with the Contract Documents, but shall be entitled to enforce any requirements in the Contract Documents specifying particular means, methods, techniques, sequences, or procedures. 10.4 The Designer shall be an Owner's representative during the construction period. The duties, responsibilities and authority of the Designer as the Owner's representative during construction are as set forth in the Contract Documents. ARTICLE 11. TESTING AND SURVEYING 11.1 Laboratory and field tests to determine compliance of construction with the Contract Documents shall be made by the Owner or testing consultants employed by the Owner except those required elsewhere in the Contract Documents to be paid for by the Contractor. The costs and expenses of providing samples for and assistance in any testing shall be borne by the Contractor and are included in the Contract Price. Any Work in which untested materials are used without approval or written permission of the Designer shall be removed and replaced at the Contractor's expense. Work found to be unacceptable or unauthorized will not be paid for and, if directed by the Designer shall be removed and replaced at the Contractor's expense. Unless otherwise designated, tests in accordance with the cited standard methods of ASTM or other generally recognized or specifically authorized methods which are current on the date of advertisement for bids shall be made at the expense of the Owner; provided, however, in the event that after such testing any Work is found to be defective or does not meet the requirements of the Contract Documents, the costs of retesting such Work and the costs of inspection services shall be paid by the Contractor. Samples shall be taken by a testing laboratory employed by the Owner. All materials being used are subject to inspection, tests, or rejection at any time prior to or during incorporation into the Work. Copies of all Owner test reports will be furnished to the Contractor at his written request. Copies of Contractor test reports shall be furnished to the Designer upon written request. 11.2 The Owner shall have the right to deduct the costs of additional testing as described in paragraph 11.1 from any money due the Contractor; or if no money is due the Contractor, the Owner shall have the right to recover these costs from the Contractor, from its sureties, or from both. 11.3 All layouts and surveying shall be accomplished by properly qualified personnel duly licensed in the State of North Carolina. ARTICLE 12. SEPARATE CONTRACTS 12.1 It is expressly understood that the Owner may deploy the Owner’s own employees or engage other separate prime contractors to perform Work as a part of the Project whose work DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 28 Revised 07/20 will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate construction activities with such other contractors, particularly with respect to access to work areas, storage of materials, and use of elevators and other common facilities. The Contractor shall diligently and in good faith cooperate with the Owner, the Designer, and all other contractors with respect to such matters and shall regularly and faithfully attend any and all meetings called by the Owner or the Designer with respect to such matters. Any disputes between the Contractor and any other separate prime contractor with respect to such matters shall be resolved in accordance with the claim and dispute resolution procedures in the Agreement. ARTICLE 13. CONTRACT TIME 13.1 Within fourteen (14) days after receipt of the Construction Contract by the Contractor for signatures, the Project Expediter shall prepare and submit to the Designer and Owner for review and approval a preliminary progress schedule for the Work pursuant to the requirements stated in the Contract Documents. 13.2 Within fourteen (14) days after initial receipt of the Construction Contract for signatures the Contractor shall submit to the Designer a Submittal Register listing all Submittals the Contractor is required to make or proposes to make under the Contract Documents, the dates on which the Contractor proposes to make such Submittals and the dates by which the Contractor reasonably requires a response from the Designer with respect to each Submittal. The dates submitted shall be incorporated into the Contract Construction Schedule as Completion Dates when they have been approved or modified by the Owner. The Designer shall not be required to review any Submittal from the Contractor until a Submittal Register acceptable to and approved by the Owner has been submitted by the Contractor. 13.3 Not later than thirty (30) days following execution and delivery of the Construction Agreement by Owner to Contractor, the Owner shall deliver to the Contractor a Notice to Proceed. The Notice to Proceed shall state a commencement date on which it is expected that the Contractor will begin the Work to be performed under the Agreement. The Contract Time shall be measured from said specified commencement date. The commencement date stated in the Notice to Proceed shall not be earlier than three (3) days after the Notice to Proceed is served on the Contractor. If, other than by mutual agreement, said specified commencement date is more than thirty (30) days after the date of execution and delivery of the Agreement from Owner to Contractor and the Contractor believes said delay justifies an increase in Contract Price or an extension of Contract Time, the Contractor may make a claim therefore as provided in Article 14 or Article 15. No Work shall be done prior to the date specified in the Notice to Proceed. A final Contract Construction Schedule shall be submitted for approval by the Contractor, Designer, and Owner no later than fourteen (14) days after Notice to Proceed. No payments shall be due the Contractor until this schedule is approved by all parties. 13.4 The Contract Construction Schedule is a Contract Document. The Contractor represents that the Contract Construction Schedule has been reviewed in detail, that the Contractor participated in its preparation, that all of the activities which impact, limit, or otherwise affect the time of completion of the Work are shown in the Contract Construction Schedule and that all of the activities of others which impact, limit, or otherwise affect the start, duration, or completion of DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 29 Revised 07/20 the Contractor’s activities are also shown. The Contractor further represents that the Contractor can and will complete each activity within the time shown for that activity. Time is of the essence with respect to each such activity and Completion Date. 13.5 If the Contractor submits a construction schedule, progress report, or any other document that indicates or otherwise expresses an intention to achieve completion of the Work prior to any Completion Date required by the Contract Documents or prior to expiration of the Contract Time, no liability of the Owner to the Contractor for any failure of the Contractor to so complete the Work shall be created or implied. 13.6 If the Contractor, for reasons beyond the Contractor’s control, is delayed in beginning any activity, the Contractor shall, nevertheless, have the same number of days as is shown in the Contract Construction Schedule for the activity, and the affected activity and any succeeding activity that is dependent upon that activity shall be adjusted accordingly; provided that at any time the Owner, by means of a Change Order, may require the Contractor to work overtime, to increase labor forces or to take any necessary or appropriate action to decrease the time required for any activity, and the Contractor shall be entitled to an adjustment in the Contract Price computed in accordance with Article 15 of these General Conditions. 13.7 At any time, the Owner may order the Contractor, on seven (7) days written notice, to begin any activity earlier than the starting date shown on the Contract Construction Schedule. 13.8 Should the Contractor fail to start any activity on the start date shown in the Contract Construction Schedule or as it may have been adjusted in accordance with paragraphs 13.5 or 13.6 above, or become delayed, the Contractor shall, without being entitled to any increase in the Contract Price or other compensation, work overtime, increase labor forces or take such other action as may be necessary or appropriate to complete the activity by the Completion Date shown on the Contract Construction Schedule, or as such Completion Date may have been adjusted. 13.9 The Designer and Owner or his Construction Consultant shall monitor progress of the work at all times and the Contractor shall cooperate with such monitoring and provide any and all information with respect to the progress of the Work and scheduling as the Owner may reasonably require. 13.10 On a monthly basis, the Contractor shall revise the Contract Construction Schedule, showing any adjustments made in accordance with paragraphs 13.5 or 13.6, above, by any Change Order, the progress of the Work, and any days gained or days lost with respect to any activity, and shall furnish copies thereof to the Owner and Designer. 13.11 Should any monthly revision of any Contract Construction Schedule show that the Contractor is behind on any activity, the late completion of which could delay Substantial Completion of the Work, the Owner shall be entitled to withhold from the next Progress Payment due the Contractor an amount not exceeding the amount the Owner would be entitled to in Liquidated Damages, should Substantial Completion be delayed by the same number of days that the Contractor is currently behind schedule. If, subsequently, the Contractor's progress, as shown by any succeeding monthly revision to the Contract Construction Schedule, is such that the anticipated delay no longer exists, the Owner shall pay with the Progress Payment next due to the Contractor such amounts as have been withheld in accordance with this paragraph. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 30 Revised 07/20 13.12 The Owner shall have the right to perform Work, hire and employ labor and craftsmen, rent equipment, subcontract with other parties, or do anything that the Owner deems necessary or appropriate to remedy or cure any delay by the Contractor in the progress of the Work. Such action by the Owner shall not, in any way, affect, void or limit any warranty, guaranty or other responsibility of the Contractor under the Contract Documents. Such action may be taken by the Owner only after three (3) days written notice to the Contractor. All costs incurred by the Owner in taking any such action shall be charged to the Contractor and deducted from any amounts remaining due under the Agreement. 13.13 The Contractor may be entitled to an extension of the Contract Time (but no increase in the Contract Sum) for delays arising from unforeseen causes beyond the control and without the fault or negligence of the Owner, the Contractor or the Contractor’s Subcontractors as follows: a) Labor disputes and strikes that directly impact the critical path activities of the Contract Construction Schedule; b) Acts of God, tornado, fire, hurricane, blizzard, earthquake, typhoon, or flood that damage completed Work or stored materials. c) Acts of the public enemy; acts of the State, Federal, or local government in their sovereign capacities. d) Abnormal inclement weather as defined in Article 13.14. 13.14 On any day that the Contractor considers that the Project is delayed by adverse weather conditions, the Contractor shall identify in writing to the Designer and the Owner the adverse weather conditions affecting each activity, the specific nature of the activity affected, the number of hours lost, and the number of and identity (by responsibility or trade) of workers affected and shall obtain from the Designer written recognition of the delay. The time for performance of this Contract includes an allowance for a number of calendar days which may not be suitable for construction Work by reason of adverse weather. The Contract Time will be extended only if the number of calendar days of adverse weather recognized by the Designer exceeds the number of inclement weather days set forth below, and the Contractor demonstrates how this adverse weather impacts activities on the critical path of the Contract Construction Schedule. Month Number of Inclement Weather Days January 10 February 10 March 10 April 9 May 10 June 9 July 11 August 10 September 8 October 7 November 8 December 9 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 31 Revised 07/20 13.15 If the Contractor believes that the progress of the Work has been adversely affected by adverse weather recognized by the Designer during a particular month, the Contractor shall submit a written request for extension of time to the Designer. Such a request for time extension of the Contract Time shall be submitted by the tenth (10th) day of the month following that month in which the adverse weather is encountered. The request shall include, but is not limited to, the following information: a) Detailed description of weather's effect on scheduled activities and its net effect on the critical path of the Project, and b) Weather records from the official weather station nearest the Project site and records of actual observation as contained in daily reports, correspondence, or other documentation. 13.16 The Contractor specifically recognizes that a delay by the Contractor in achieving any Completion Date can have the effect of delaying the Substantial Completion of the Project, that such delay in Substantial Completion of the Project will necessarily cause damages, losses, and expenses to the Owner, including, but not limited to and by way of illustration only, increased capitalized costs and interests for the Project, increased and extended Project overhead, Designer's and Consultant's fees, increased costs of construction, increased and extended operation costs of other facilities, and inefficiency and loss of productivity, and that such damages, losses, and expenses may not be readily identifiable or ascertainable at the time they are incurred or at any time. Therefore, and in recognition of these factors and the likelihood that actual damages from his delay will not be readily ascertainable, the Contractor agrees to pay to the Owner, as Liquidated Damages and not as a penalty, the sum identified in the Contract Documents hereto as the Liquidated Damages per Day, for each day by which the failure to meet any Completion Date shown in the Contract Construction Schedule, adjusted in accordance with this Article, delays the Substantial Completion of the Project. 13.17 The Contractor shall not be entitled to any adjustment in the Contract Price or other compensation from the Owner for any delay in the completion of or progress on the Work that is caused by a force majeure condition or is otherwise not caused by the sole and direct act or omission of the Owner and the Owner’s employees or agents. 13.18 The sum for Liquidated Damages is the amount stated in the Contract Documents as Liquidated Damages reasonably estimated in advance to cover the losses to be incurred by the Owner by reason of failure of said Contractor(s) to complete the Work within the time specified, such time being in the essence of this contract and a material consideration thereof. ARTICLE 14. CHANGES IN THE WORK 14.1 Without invalidating the Contract Documents, the Owner may, at any time, or from time to time order additions, deletions, or revisions in the Work. Said additions, deletions, or revisions shall be authorized only by written Change Orders, Construction Change Directives or Field Orders. Upon receipt of a Change Order, Construction Change Directive or Field Order, the Contractor shall proceed with the Work involved. All such Work shall be executed under the applicable conditions of the Contract Documents. If any change causes an increase or decrease in the Contract Price or an extension or shortening of the Contract Time, adjustments shall be made as provided in Article 14 or Article 15. In order to expedite the Work and avoid or minimize delay in the Work that might affect the Contract Price or Contract Time, the Designer may issue a Change Order in the form of a Construction Change Directive which when signed by the Owner and Designer, directs the Contractor to proceed promptly with the Work involved. Any claim for an adjustment in Contract Price or Time, if not defined in the Construction Change DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 32 Revised 07/20 Directive, shall be promptly made in writing in accordance with the procedures defined in Article 15.2. 14.2 The Designer may authorize minor changes or alterations in the Work not involving change in the Contract Price or in the Contract Time and not inconsistent with the overall intent of the Contract Documents. These may be accomplished by a Field Order. Such alterations shall not invalidate the Contract Documents nor release the surety. If the Contractor believes that any minor change or alteration authorized by the Designer entitles him to an increase in the Contract Price or an extension of Contract Time, he may make a claim therefore as provided in Article 14 or Article 15. 14.3 Except in an emergency endangering life or property, no change shall be made by the Contractor except upon prior written Change Order, Directive or Field Order authorizing such Change. 14.4 Increases in the Contract Price or extensions of the Contract Time for additional Work performed by the Contractor shall only be in accordance with a written Change Order signed by the Owner and Designer. The Contractor shall not be entitled to additional time or to additional compensation for any Work performed or material supplied which is claimed to have been authorized or settled by an "oral" change, or by a "constructive" or "implied" change, or by a course of conduct, or by any action or non-action by the Owner, Designer, or any other persons, or by any means whatsoever other than by a written Change Order for such Work or material signed by the Owner and the Designer. 14.5 Changes in the Work resulting from emergency shall not invalidate the Contract Documents nor release the surety. 14.6 Neither the Owner nor the Designer shall be responsible for verbal instructions which have not been confirmed in writing, and in no case shall such instructions be interpreted as permitting a departure from the Contract Documents unless such instruction is confirmed in writing and supported by a proper Change Order, Construction Change Directive or Field Order, whether or not the cost is affected. 14.7 The Owner, in its sole discretion, may require that the Contractor notify the Contractor’s sureties of any changes affecting the general scope of the Work or change in the Contract Price, and that the amount of applicable bonds shall be adjusted accordingly. If this requirement is exercised, the Contractor shall furnish proof of such adjustment to the Designer and the Owner. If this requirement is exercised, the Change Orders shall require written consent of the Contractor's surety. At the time of signing a Change Order, the Contractor shall be required to certify as follows: "I certify that all sureties have been notified that my contract has been altered by the amount of this Change Order, and that a copy of the approved Change Order will be mailed to all sureties upon its receipt by me." If this requirement is exercised, no payment to the Contractor on account of any Change Order shall become due or payable until written evidence of the surety's consent to the Change Order has been furnished to the Designer and to the Owner, and the furnishing of such written consent is a condition precedent to such payment. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 33 Revised 07/20 14.8 The Contractor shall support all requests for Change Orders with a detailed cost breakdown showing cost of materials, labor, equipment, transportation, other items, Contractor's overhead and profit, and total cost, in accordance with methods defined in this Article, and, if the request seeks an extension of the Contract Time, with a time-related diagram which demonstrates specifically why an increase in construction time is needed. 14.9 When a request for a Change Order involves a Subcontractor, the Contractor shall provide quotation from same on Subcontractor's letterhead. The Subcontractor's quote shall list materials, equipment, and labor separately, and show overhead and profit in the manner provided in paragraph 14.8. ARTICLE 15. CHANGE OF THE CONTRACT PRICE 15.1 The Contract Price constitutes the total compensation payable to the Contractor for performing all Work under the Contract Documents. All duties, responsibilities, and obligations assigned to or undertaken by the Contractor shall be at his expense without change in the Contract Price. The Contract Price may only be changed by a Change Order. 15.2 Any claim for an adjustment in the Contract Price shall be in writing and written notice of any event, action, or non-action which may become the basis of a claim shall be delivered to the Owner and the Designer within three (3) days of the occurrence of any such event, action or non-action giving rise to the claim. Such written notice is a condition precedent to the making of a claim, and such notice shall describe the basis of the potential claim with reasonable detail and clarity. A claim shall be made in writing and shall be delivered to the Designer and the Owner no later than fourteen (14) days after such notice. The claim shall describe in detail the basis for the claim, with specific reference to any provisions of the Contract Documents, by paragraph, drawing number, or other specific identification, and shall state the amount claimed and how it is calculated. If the Contractor, at the time the claim is made, is unable to state the amount claimed with accuracy, the Contractor shall so state and provide the estimated amount and the basis on which the amount is to be calculated. At the earliest date practicable, but in no event more than thirty (30) days after Contractor's notice of claim, the Contractor shall supplement the claim with an accurate statement of the amount claimed and how it has been calculated. The Contractor shall provide, in writing, in support of the claim all such explanations, arguments, data, receipts, expert opinions, or other documents or information as the Contractor deems appropriate to be considered in support of the claim. A claim may properly be rejected by the Owner by reason of the Contractor's failure to submit adequate or accurate documentation or information, except that within seven (7) days after being given notice that the claim has been rejected on this basis, the Contractor may submit additional documentation or information. No claim for a change of the Contract Price shall be considered or granted (except solely at the discretion of the Owner) unless a claim is so made, nor shall the Contractor be entitled to any increase in the Contract Price unless the Contractor has given notice and made such a written claim within the times required. The Owner shall decide, after obtaining the advice of the Designer, whether an increase in Contract Price is warranted, and the amount of such increase shall be determined as provided in paragraph 15.4 through 15.5, below. Any change in the Contract Price resulting from any such claim shall be incorporated in a Change Order. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 34 Revised 07/20 The Owner shall advise the Contractor of its decision with respect to the claim within fourteen (14) days of its receipt, or of the receipt of additional documentation or information if the absence of such has previously been the basis of rejection of the claim; provided, however, that if, in its sole discretion, the Owner deems that review or consideration of any part of the claim or any matter related thereto by its governing Board is necessary or appropriate, it shall so advise the Contractor and shall provide its decision to the Contractor within seven (7) days after such Board consideration, review or action. Any claim on which the Owner has not provided its decision to the Contractor within the applicable time period shall be deemed denied. If the Contractor is not satisfied with the decision of the Owner, the Contractor may within seven (7) days of receipt of the Owner's decision initiate the mediation process as described in Appendix A to the General Conditions of the Contract for Construction. 15.3 In determining the amount of a Contract Price adjustment, the parties shall apply the following methods, as appropriate: (A) Change in Work: The Owner and Contractor shall negotiate in good faith and attempt to agree upon the value of any change (extra or decrease) in Work prior to the issuance of a Change Order covering said Work. Such Change Order shall set forth the corresponding adjustment to the Contract Price. In the event the Owner and the Contractor are unable to agree, the Owner shall grant an equitable adjustment in the Contract Price. (B) Emergency Work: In the event of emergency endangering life or property, the Contractor may be directed by the Designer to proceed on a time and material basis, whereupon the Contractor shall so proceed and keep accurately, in such form as may be required by the Designer, a correct account of costs together with all proper invoices, payrolls, and supporting data therefore. 15.4 W here the Contract Price is to be adjusted, the following limitations shall apply in determining the amount of adjustment: (A) In the case of extra or emergency work, the Contract Price shall not be increased by more than the reasonable, actual, and documented net cost of the extra or emergency work plus ten percent (10%) of such net cost on Work performed by the Contractor and five percent (5%) thereof on any subcontracted Work for overhead and profit combined. (B) In the case of a decrease in Work, the Contract Price shall not be decreased by less than the net cost of the deleted Work plus five percent (5%) of such direct net cost for profit and overhead. The term 'net cost' as used herein shall include, as applicable, and shall be limited to, all direct labor, direct material, direct equipment, labor burden, sales taxes, shipping and handling charges, permits and fees, and insurance and bond premium adjustments, if any, attributable to the change. All other items of cost shall be considered as overhead and covered by the percentages allowed in sections A and B of this paragraph. The Contractor shall provide worksheets or tabulations describing the method by which the direct net cost was calculated, and shall provide all data needed to support the calculation of the direct net cost, all in a form acceptable to the Owner. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 35 Revised 07/20 15.5 Where the Contract Price is to be adjusted by negotiation, the Owner may authorize and designate the Designer to negotiate with the Contractor on behalf of the Owner; provided, however, any agreement reached between the Contractor and Designer shall be subject to approval by the Owner. ARTICLE 16. UNFORESEEN CONDITIONS 16.1 Should the Contractor encounter unforeseen conditions at the Project site materially differing from those shown on the Drawings or indicated in the Specifications or differing materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in this Agreement, the Contractor shall immediately, and in no event more than three days later, give notice to the Owner of such conditions before they are disturbed. The Owner and the Designer shall thereupon promptly investigate the conditions and if they find that they materially differ from those shown on the Drawings or indicated in the Specifications, they shall at once make such changes in the Drawings and Specifications as they may find necessary. Any increase or decrease in the Contract Price resulting from such changes shall be adjusted in the manner provided herein for adjustments as to extra or additional Work and changes. However, neither the Owner nor the Designer shall be liable or responsible for additional work, costs, or changes to the Work that could have been reasonably determined from any reports, surveys, and analyses made available for the Contractor's review or that could have been discovered by the Contractor through the performance of its obligations pursuant to the Contract Documents. ARTICLE 17. CORRECTION OF WORK BEFORE FINAL PAYMENT 17.1 The Owner has the authority to stop or suspend work, and the Designer has the authority to order Work removed or to order corrections of defective Work or Work not in compliance with the Contract Documents where such action may be necessary to ensure successful completion of the Work. Any work, materials, fabricated items, or other parts of the Work which have been found by the Designer to be defective or not in accordance with the Contract Documents shall be condemned and shall be removed from the Project by the Contractor, and immediately replaced by new Work in accordance with the Contract Documents at no additional cost to the Owner. Work or property of the Owner or others damaged or destroyed by virtue of such condemned Work shall be made good at the expense of the Contractor. Correction of condemned Work described above shall be commenced by the Contractor within twenty-four (24) hours after notice from the Designer or the Owner and shall be pursued to completion. Should the Contractor fail to proceed reasonably with the abovementioned corrections, the Owner may, three (3) days after the notice specified in the preceding sentence, proceed with correction, paying the cost, including costs of uncovering such condemned Work, of such corrections from amounts due or to become due to the Contractor. Condemned Work removed shall be the property of the Contractor and shall be removed from the Project by him within ten (10) days after notice to remove it, and if not then removed, thereafter may be disposed of by the Owner without compensation to the Contractor and the cost of such disposal shall be deducted from amounts due or to become due to the Contractor. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 36 Revised 07/20 Should the cost of correction of the Work and, if applicable, disposal of the condemned Work by the Owner exceed amounts due or to become due the Contractor, then the Contractor and the Contractor’s sureties shall be liable for and shall pay to the Owner the amount of such excess. ARTICLE 18. CORRECTION OF WORK AFTER SUBSTANTIAL COMPLETION; WARRANTIES AND GUARANTIES 18.1 Neither the final certificate, Final Payment, occupation of the premises by the Owner, nor any provision of the Contract Documents, nor any other act or instrument of the Owner or the Designer shall relieve the Contractor from responsibility for negligence, defective material or workmanship, or failure to comply with the Contract Documents. 18.2 The Contractor shall, at the Contractor’s sole cost and expense, make all necessary repairs, replacements, and corrections of any nature or description, interior or exterior, structural or non-structural, that shall become necessary by reason of defective workmanship or materials which appear within a period of one (1) year from the date of Substantial Completion; provided, however that notwithstanding the preceding, if any longer guarantee period is specified for any particular materials or workmanship under the Contract Documents, or under any subcontract, or in connection with any manufactured unit which is installed in the Project, or under the laws of the State of North Carolina, the longer guarantee period shall govern. 18.3 If, within any guarantee period, repairs or changes are required in connection with the Work, which are rendered necessary as the result of the use of materials, equipment, or workmanship which are inferior, defective, or not in accordance with the terms of the Contract Documents, the Contractor shall, promptly upon receipt of notice from the Designer and without expense to the Owner: a) Completely repair or replace the Work so that it conforms to the Contract Documents; b) Correct all defects therein; c) Make good all damage which, in the opinion of the Designer, is the result of the use of materials, equipment, or workmanship which are inferior, defective, or not in accordance with the terms of the Contract Documents; and d) Make good any Work or material, or any equipment or contents disturbed in fulfilling any such guarantee. If, in fulfilling the requirements of the Contract Documents or of any guarantee embraced therein or required thereby, the Contractor disturbs any work, facility, premises, or construction belonging to the Owner, the Contractor shall restore such disturbed work to a condition satisfactory to the Owner, and shall guarantee such restored work to the same extent as if it were Work under the Contract Documents. If the Contractor, after notice, fails to proceed promptly to comply with the terms of the guarantee, the Owner may have the defects corrected, and the Contractor and the Contractor’s ureties shall be liable for all expenses incurred. "Promptly" is defined as within twenty-four (24) DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 37 Revised 07/20 hours for systems necessary to normal operation of the building and within seventy-two (72) hours for all other items. All special guarantees applicable to definite parts of the Work that may be shown in or required by Contract Documents shall be subject to the terms of this paragraph during the first year of the life of such special guarantee. Manufacturer's standard guarantees or warranties which do not comply with the time limit specified herein shall be extended by the Contractor automatically without further action on the part of the Owner or the Designer. 18.4 In the eleventh calendar month after the date of Substantial Completion, and at the request of the Owner, the Contractor, the Owner and the Designer shall make an inspection of the Work for the purpose of identifying defective workmanship or materials. If the Contractor, having been requested to do so by the Owner, fails to participate in such inspection, the Contractor shall be conclusively bound by any decision or ruling by the Designer as to any defective workmanship or material and as to the Contractor's responsibility for its repair or replacement. ARTICLE 19. OWNER'S RIGHT TO DO WORK 19.1 If, during the progress of the Work or during any period of guarantee, the Contractor fails to prosecute the Work properly or to perform any provision of the Contract Documents, the Owner, after three (3) days written notice to the Contractor from the Designer, or from the Owner after Final Payment, may perform or have performed that portion of the Work and may deduct the cost thereof from any amounts due or to become due the Contractor. Notwithstanding any action by the Owner under this paragraph, all warranties and bonds given or to be given by the Contractor shall remain in effect or shall be given by the Contractor. 19.2 Should the cost of such action by the Owner exceed the amount due or to become due the Contractor, the Contractor and his sureties shall be liable for and shall pay to the Owner the amount of such excess. ARTICLE 20. PARTIAL PAYMENTS 20.1 Within thirty (30) days after his initial receipt of the Construction Contract for signatures, the Contractor shall submit to the Designer a Schedule of Values. The Schedule of Values shall indicate the value of the Work, including applicable overhead and profit, for each Division and section of the Project Specifications. The Designer and Owner shall be provided with the Contractor's estimate papers, Subcontractor agreements, supplier quotes, or other documents substantiating these values if so requested in writing by the Designer. The Contractor shall provide the requested documentation within seven (7) days after receipt of the Designer's written request. The Schedule of Values shall be subject to approval by the Owner, and if the Owner and the Contractor cannot agree upon the Schedule of Values, the Designer shall prepare it, and the Schedule of Values as prepared by the Designer shall be binding on the Owner and the Contractor. No Request for Payment shall be certified by the Designer until the Designer has issued approval of said Schedule of Values. 20.2 Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Designer a Request for Payment for Work done during the previous calendar month. The Request for Payment shall be in form of AIA Document G702 (latest edition) and shall show substantially the value of Work done (including the value of material delivered to the Project or stored by the Contractor at another site, subject to the conditions hereinafter set forth) during DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 38 Revised 07/20 the previous calendar month, and shall sum up the financial status of the Work with the following information: a) Total Contract Price, including any adjustment thereto made pursuant to the Contract Documents. b) Value of Work completed and materials properly stored to date. c) Less amount retained. d) Less previous payments. e) Current amount due. f) Balance remaining. The Contractor, upon request of the Designer, shall substantiate the request with invoices, vouchers, payrolls, or other evidence. 20.3 When payment is requested or made on an account of stored materials, such materials must be stored on the Owner's property at such places and in such a manner as may be designated by the Designer. However, in the sole discretion of the Owner, with permission in writing from the Designer and Owner and under such circumstances as may be determined by the Owner, such materials may be stored in a bonded warehouse. The location and conditions for storage of such materials away from the Owner's property in a bonded warehouse shall be within the sole discretion of the Owner. Requests for Payment on account of stored materials shall be accompanied by paid invoices, bills of sale, warehouse receipts, or other documentary evidence establishing Owner's title to such materials, evidence that the stored materials are insured against loss and damage, and such other documentation as required by the Designer. Responsibility for the quantity, quality, and condition of such stored materials, whether stored on the Owner's property or away from the Owner's property, shall remain with the Contractor regardless of ownership or title. No payment shall be made on account of materials stored in a bonded warehouse unless the Contractor has acquired written permission from the Designer for such storage of materials and has complied with all conditions set forth in such permission regarding such storage of materials in a bonded warehouse. 20.4 Any Request for Payment received by the Designer on or before the fifth (5th) of the calendar month shall be certified for payment or returned for re-submission to the Contractor on or before the fifteenth (15th) of the calendar month. The Designer's certification shall be for the amount which was requested or that which the Designer has decided was justly due, and shall state in writing to the Contractor and Owner the reasons for withholding payment of any or all of the amount requested. 20.5 The Designer may fail to certify all or part of any payment requested for any of the following reasons: a) Defective Work not corrected. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 39 Revised 07/20 b) Suits, actions, or claims of any character filed against the Contractor, or due to the operations of the Contractor, or information or notice that a suit, action, or claim will be filed or has been made. c) Information or notice that a Subcontractor or a supplier has not received payment. d) The balance unpaid of the Contract Price is insufficient to complete the Work in the judgment of the Designer or Owner. e) Damage to the Owner or another contractor. f) Inability of the Contractor to meet a Completion Date, including an anticipated failure to meet a Completion Date entitling the Owner to withhold anticipated Liquidated Damages in accordance with paragraphs 13.15 and 13.17 hereof. g) Failure to furnish Submittal as required by the Contract Documents on a timely basis in accordance with the Submittal Register. h) Such other reason as to the Designer may appear prudent, proper, or equitable. When grounds for withholding certification have been corrected, the Designer shall so certify to the Owner and the Owner shall make any payment due with respect to such certification as a part of his next payment after such certification. 20.6 No certificate issued or progress payment made shall constitute an acceptance of the Work or any part thereof. 20.7 The amount certified by the Designer for payment shall be ninety-five percent (95%) of the value of Work completed and materials stored since the Designer's last certification as shown on the Request for Payment, less any amounts not certified in accordance with paragraph 20.4, and this amount shall be paid by the Owner on or before the last business day of the month, but payment shall not be past due until not paid within fifteen (15) days thereafter. 20.8 After certification by the Designer that the Work is fifty percent (50%) complete, based on a determination that the Contractor's gross project invoices, excluding the value of materials stored off-site, equal or exceed fifty percent (50%) of the value of the Contract, (except the value of materials stored on-site shall not exceed twenty percent (20%) of the Contractor's gross project invoices for the purpose of determining whether the Project is fifty percent (50%) complete) and the Contractor has provided to the Owner the written consent of its sureties to the cessation of further percentage retention, the amount certified for payment with respect to subsequent Requests for Payment shall be one hundred percent (100%) of the value of Work completed and materials stored since the Designer's last certification as shown on the Request for Payment, less any amounts not certified in accordance with paragraphs 20.4 and 20.5; provided, however, that the aggregate of periodic payments shall not exceed ninety-seven and one half percent (97.5%) of the Contract Price. If the Owner determines that the Contractor's performance under the Contract is unsatisfactory, the Owner may resume withholding percentage retention from each subsequent periodic payment application up to the maximum amount of five percent (5%) of the Contract Price. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 40 Revised 07/20 ARTICLE 21. FINAL PAYMENT 21.1 If the Work of the Contractor is limited to demolition, pilings, caissons and structural steel, the remaining unpaid balance of the Contractor’s Contract Price, less a sum equal to five-tenths percent (0.5%) of the Contract Price, shall be paid within sixty days following receipt of the following documents, all of which must be received before payment shall become due: (i) request for payment from the Contractor; (ii) receipt of consent from the Contractor’s surety to the payment; and (iii) approval or certification from the Designer that the work performed by the Contractor is acceptable and in accordance with the Contract Documents. 21.2 Except as set forth in paragraph 21.1, within forty five days after Substantial Completion of the Project, the remaining unpaid balance of the Contract Price shall be paid to the Contractor, less an amount equal to two and one-half times the value of punch list work or other work remaining to be completed or corrected, as reasonably estimated by the Owner. 21.3 Upon Substantial Completion, the Designer shall prepare and submit to the Contractor a deficiency list identifying all portions of the Work which are known by the Designer at that time to be incomplete or defective. Within thirty (30) days of receipt of this deficiency list, the Contractor shall complete and correct all items on that list along with all other Work required to achieve Final Completion of the Work. At any time prior to completion of the period of warranty, the Designer may submit to the Contractor a supplemental deficiency list, in which case the Contractor shall complete or correct any and all new items identified on the supplemental deficiency list within the time period stipulated in paragraph 18.3. 21.4 Final Payment of any remaining balance of the Contract Price shall not be due to the Contractor until the Contractor achieves Final Completion of the Project. 21.5 The making and acceptance of Final Payment shall constitute a waiver of all claims by the Owner except: a) Claims arising from unsettled liens or claims against the Contractor. b) Defective Work or materials appearing after Final Payment. c) Failure of the Contractor to perform the Work in accordance with the Contract Documents. d) As conditioned in the Performance Bond. e) Claims made prior to Final Payment which remain unsettled. f) Amounts due arising under Articles 18 and 28. g) Claims for recovery of overpayment based upon incorrect measurement, estimate, or certificate. 21.6 The making and acceptance of Final Payment shall constitute a waiver of all claims by the Contractor except those claims previously made in writing pursuant to paragraph 15.2 and not finally resolved. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 41 Revised 07/20 21.7 The Designer shall not authorize Final Payment until all of the Work under the Contract Documents has been certified by the Designer as completed, proper and suitable for occupancy and use, and has been approved by all federal, state and local agencies having jurisdiction. 21.8 The final Request for Payment shall be identified on its face as such and shall be presented by the Contractor to the Designer within thirty (30) days of completion of the Work. Final payment of the retained amount due the Contractor shall be made by the Owner within thirty (30) days after the later of (i) full and Final Completion of all Work required by the Contract Documents, and certification of such Work in accordance with paragraph 20.4; (ii) submission of the affidavits of other documentation required by Article 22; (iii) submission by the Contractor of a Request for Payment identified on its face as final and including the Designer's certification. ARTICLE 22. CONTRACTOR, SUBCONTRACTOR AND SUPPLIER AFFIDAVIT 22.1 The Final Payment due the Contractor on account of the Contract Documents shall not become due until the Contractor has furnished to the Owner through the Designer: (A) an affidavit by the Contractor signed, sworn, and notarized to the effect that all payments for materials, services, or for any other reason in connection with the Work or performance of the Contract Documents have been satisfied and that no claims or liens exist against the Contractor in connection with the same; (B) affidavits from each Subcontractor and supplier signed, sworn, and notarized to the effect that (i) each such Subcontractor or supplier has been paid in full by the Contractor for all Work performed and materials supplied by him in connection with the Project, and (ii) that all payments for materials, services, and for any other reason in connection with the subcontract or supply contract have been satisfied and that no claims or liens exist against the Subcontractor or supplier in connection therewith; and (C) the written consent of the Contractor’s sureties to Final Payment. In the event that the Contractor cannot obtain an affidavit, as required above, from any Subcontractor or supplier, the Contractor shall state in the Contractor’s affidavit that no claims or liens exist against such Subcontractor or supplier to the best of the Contractor's knowledge, and that if any appear afterwards, the Contractor shall save the Owner harmless for all costs and expenses, including attorneys’ fees, on account thereof. ARTICLE 23. ASSIGNMENTS AND SUBCONTRACTS 23.1 The Contractor shall not assign any portion of this Agreement nor subcontract the Work in its entirety without the prior written consent of the Owner. Except as may be required under terms of the bonds required by the Contract Documents, no funds or sums of money due or to become due to the Contractor under the Contract Documents may be assigned. ARTICLE 24. MEASUREMENTS 24.1 Before ordering material or doing Work which is dependent for proper size or installation upon coordination with building conditions, the Contractor shall verif y all dimensions and shall be responsible for the correctness of same. No consideration will be given for any claim based on differences between the actual dimensions and those indicated in the Contract Documents. Any discrepancies between the Contract Documents and the existing conditions shall be referred to the Designer for adjustment before any Work affected thereby is begun. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 42 Revised 07/20 ARTICLE 25. CONTRACTOR AND SUBCONTRACTOR RELATIONSHIPS 25.1 Within thirty (30) days after initial receipt of the Construction Contract for signatures the Contractor shall submit to the Designer and Owner for acceptance a current list of the names of Subcontractors and such other persons and organizations (including those who are to furnish materials or equipment fabricated to a special design) proposed for any and all portions of the Work. The Contractor shall provide this list at this time even if the Contractor was required to submit a list of proposed Subcontractors with the Contractor’s bid. The Designer shall promptly reply to the Contractor in writing stating whether or not the Owner or the Designer, after due investigation, has objection to any such proposed person or entity or if it needs additional information to evaluate the persons on the list. Failure of the Designer to reply within ten (10) days after the Contractor has furnished all required information shall constitute notice of no objection. The Contractor shall not contract with any such proposed person or entity to whom the Owner or the Designer has made reasonable objection. If the Designer or Owner has reasonable objection to any such proposed person or entity, the Contractor shall submit a substitute to whom the Owner and the Designer have no reasonable objection. The Contractor shall make no substitution for any Subcontractor, person, or entity previously allowed without first notifying the Designer and Owner in writing and no substitution may be made if the Owner or Designer makes a reasonable objection to such substitution. 25.2 The Contractor agrees that the terms of the Contract Documents, including all portions thereof, shall apply to all Subcontractors of the Contractor as if they were the Contractor, and that the Subcontractors of the Contractor shall, by means of their subcontracts, be bound by all the terms of the Contract Documents including, but not limited to, Article 26 of these General Conditions. 25.3 Payments to Subcontractors shall be made in accordance with the provisions of N.C. Gen. Stat. §143-134.1. ARTICLE 26. USE OF PREMISES 26.1 The Contractor shall confine apparatus, the storage of materials, the operations of workers, and the disposal of material to limits indicated by law, ordinances, permits, and directions of the Designer, if any. 26.2 The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance, or configuration. 26.3 The Contractor shall enforce all of the Designer's instructions, including, but not limited to, those regarding signs, advertisements, fires, and smoking. ARTICLE 27. CUTTING, PATCHING AND FITTING 27.1 The Contractor shall do all cutting, fitting, and patching of the Work that may be required to make its several parts come together properly and fit it to receive or to be received by Work shown in or which can be reasonably implied from the Contract Documents. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 43 Revised 07/20 ARTICLE 28. DISPUTE RESOLUTION 28.1 The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret, or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina, and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. In any dispute arising pursuant to the terms of this Agreement the Parties shall follow and abide by the Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Regardless of the outcome of any dispute each Party shall be responsible for its own legal costs including reasonable attorneys’ fees. 28.2 Any person or firm that expressly or impliedly agrees to perform labor or services or to provide material, supplies, equipment, work, performance or payment bonds, insurance or indemnification for the construction of the Project or the Work shall be deemed a party to this Agreement solely for the purpose of this Article 28. The Contractor, by means of its subcontracts, shall specifically require its Subcontractors to be bound by this Article. ARTICLE 29. TAXES 29.1 The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. The Contractor shall maintain all tax records during the life of the Project and furnish the Owner with a complete listing of all taxes paid by taxing authority, invoice number, date, amount, etc. in a form acceptable to the Owner. The Contractor is required to maintain a file showing taxes paid on the Project for three (3) years after Final Payment or turn said documents over to the Owner for his files. 29.2 The following is a list of requirements to be followed by the Contractor in maintaining proper records and reporting the North Carolina Sales and Use Tax and Local Sales and Use Tax. The Contractor shall comply fully with the requirements outlined below, in order that the Owner may recover the amount of the tax permitted under the law. a) It shall be the Contractor's responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of his Subcontractors. Such evidence shall be transmitted to the Owner with each pay request regardless of whether taxes were paid in that period. b) The documentary evidence shall consist of a certified statement by the Contractor and each of the Contractor’s Subcontractors individually, showing total purchases of materials from each separate vendor and total sales and use taxes paid to each vendor. Certified statements must show the invoice number, or numbers, covered, and inclusive dates of such invoices. c) Materials used from Contractor's or Subcontractor's warehouse stock shall be shown in a certified statement at warehouse stock prices. d) The Contractor shall not be required to certify the Subcontractor's statements. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 44 Revised 07/20 ARTICLE 30. OPERATION OF OWNER'S FACILITIES 30.1 The Contractor agrees that all Work done under the Contract Documents shall be carried on in such a manner so as to ensure the regular and continuous operation of the adjoining or adjacent facilities. The Contractor further agrees that the sequence of operations under the Contract Documents shall be scheduled and carried out so as to ensure said regular and continuous operation. The Contractor shall not close any areas of construction until so authorized by the Designer. The Contractor shall control operations to assure the least inconvenience to the public. Under all circumstances, safety shall be the most important consideration. ARTICLE 31. THIRD PARTY BENEFICIARY CLAUSE 31.1 It is specifically agreed between the parties executing the Agreement that, with the specific exception set forth paragraph 7.24 hereof, and that exception only, the Contract Documents and the provisions therein are not intended to make the public, or any member thereof, a third-party beneficiary of the Agreement, or to authorize anyone not a party to the Contract Documents to maintain a suit for personal injuries or property damage pursuant to the terms of provisions of the Contract Documents. ARTICLE 32. MEASUREMENT OF QUANTITIES 32.1 All Work completed under the Contract Documents shall be measured by the Contractor using United States customary units of measurement. The method of measurement and computations to be used in determination of quantities of material furnished and of Work performed under the Contract Documents shall be those methods set forth in the Contract Documents or, if not specifically set forth therein, the method generally recognized as conforming to good engineering practice. ARTICLE 33. TERMINATION BY THE OWNER FOR CAUSE 33.1 If the Contractor fails to begin or complete the Work under the Contract Documents within the time specified, or fails to perform the Work with sufficient labor and equipment or with sufficient materials to insure the prompt completion of said Work, or shall perform the Work unsuitably or shall discontinue the prosecution of the Work for three (3) days, or if the Contractor shall become insolvent, be declared bankrupt, commit any act of bankruptcy or insolvency, allow any final judgment to stand against the Contractor or its affiliated companies unsatisfied for a period of forty-eight (48) hours, make an assignment for the benefit of creditors, or for any other cause whatsoever shall not carry on the Work in an acceptable manner, the Owner may give notice in writing to the Contractor and the Contractor’s sureties of such delay, neglect, or default, specifying the same, and if the Contractor within a period of three (3) days after such notice shall not proceed in good faith and with reasonable speed to correct such delay, neglect, or default in accordance with such notice, the Owner shall have full power and authority, to the extent permitted by law, without violating the Contract Documents, to take the prosecution of the Work out of the hands of the Contractor, to appropriate or use any or all materials and equipment at the Project as may be suitable and acceptable, and may enter into an agreement for the completion of the Work or pursue such other methods as in the Owner's opinion shall be necessary or appropriate for the completion of the Work in an acceptable DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 45 Revised 07/20 manner. All costs and charges incurred by the Owner in proceeding in accordance with the preceding sentence, including attorney's fees, and all costs incurred by the Owner in completing the Work shall be deducted from any money due or which becomes due the Contractor. If such costs and expenses incurred by the Owner shall be less than the sum which would have been payable under Contract Documents if it had been completed by the Contractor, then the Contractor shall be entitled to receive the difference, but if such costs and expenses shall exceed the sum which would have been payable under the Contract Documents, the Contractor and the Contractor’s surety shall be liable to the Owner for and shall pay to the Owner the amount of such excess. ARTICLE 34. TERMINATION OR SUSPENSION BY THE OWNER FOR CONVENIENCE 34.1 The Owner may, without cause, order the Contractor to terminate, suspend, delay, or interrupt the Work in whole or in part for such period of time as the Owner may determine. 34.2 If the Contractor is subsequently ordered by the Owner to resume the Work, any cost or expenses to which the Contractor may be entitled by reason of the suspension, delay, or interruption shall be recovered by means of a Change Order in accordance with Articles 13 and 14 hereof and the Contract Construction Schedule shall be adjusted in accordance with Article 13 hereof. 34.3 In the event of termination by the Owner under this Article, the Contractor shall be entitled to receive the reasonable and documented direct costs incurred prior to termination, including the cost of materials purchased for the Work which purchases cannot be canceled or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the Project in a safe and efficient manner, plus ten percent (10%) thereof for overhead and profit, subject to the following conditions: a) When the Contract is terminated before completion of all items of Work, payment shall be made for the actual number of units or items of Work completed at the applicable contract prices, or as mutually agreed for items of Work partially complete. If a mutual agreement cannot be reached, the Owner shall have the authority to make such equitable adjustment as it deems warranted and the Final Payment shall be made accordingly. b) Reimbursement for organization of any Work and moving equipment to and from the job shall be considered when not otherwise provided for in the Contract Documents where the volume of completed Work is too small to compensate the Contractor for those expenses under unit prices. If a mutual agreement cannot be reached, the Owner will have the authority to make such equitable adjustments as it deems warranted and the Final Payment will be made accordingly. c) Materials obtained by the Contractor for the Work that have been inspected and accepted by the Designer and that are not incorporated in the Work shall, at the request of the Contractor, be purchased from the Contractor at the Contractor's actual cost as shown by receipted bills and actual costs records at such points of delivery as may be determined by the Owner. d) No payment shall be made by Owner to Contractor except as herein above provided. No claim for loss of anticipated profits shall be considered or allowed. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 46 Revised 07/20 e) Termination of the Contract shall not relieve the Contractor of his responsibilities for any completed portion of the Work nor shall it relieve his sureties of their obligation for and concerning any just claims arising out of the Work performed. The Contractor shall not be entitled to any other compensation, including compensation for lost profit, lost opportunity, or any other direct or consequential cost, loss, or damage. f) Either party may terminate this Agreement upon notice to the other party that obligations pursuant to this Agreement are made impossible due to declarations of emergency by Orange County or by North Carolina due to events directly impacting Orange County. Both parties shall remain responsible for all payment and performance due up to the receipt of such notice, but shall have no further obligation or responsibility beyond that date provided the terminating party has taken all reasonable steps to complete the performance of its obligations. ARTICLE 35 MINORITY BUSINESS ENTERPRISE PROGRAM 35.1 The Contractor shall at all times comply with the Orange County Minority Business Enterprise Policy. All documentation substantiating compliance with the requirements of this program shall be delivered to the Owner as stipulated in the Contract Documents. A copy of the Orange County Minority Business Enterprise Policy is included in the Project Manual. ARTICLE 36 E-VERIFY AND DIGITAL SIGNATURES 36.1 By executing the Agreement Contractor affirms Contractor, its agents and subcontractors, are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. 36.2 This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. 36.3 By executing the Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. 36.4 By executing the Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. ARTICLE 37 GENERAL 37.1 If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. 37.2 The titles to Articles herein are for convenience only, are not substantive parts of the General Conditions, and are not to be considered in interpreting the Contract Documents. END OF GENERAL CONDITIONS OF THE CONTRACT FOR CONSTRUCTION—EXHIBIT 1 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 ORANGE COUNTY NORTH CAROLINA DISPUTE RESOLUTION RULES AND PROCEDURES FOR ORANGE COUNTY DESIGN, BUILDING CONSTRUCTION, RENOVATION, AND REPAIR PROJECTS RULE 1. INITIATING MEDIATED SETTLEMENT CONFERENCES A. Purpose of Mandatory Settlement Conferences. Pursuant to G.S. §143-128(f1) and 143- 135.26(11), these Rules are promulgated to implement a mediated settlement program designed to focus the parties’ attention on settlement rather than on claim preparation and to provide an opportunity for orderly settlement negotiations to take place. Nothing herein is intended to limit or prevent the parties from engaging in settlement procedures voluntarily at any time prior to or during commencement of the dispute resolution process. B. Initiating the Dispute Resolution Process 1. Any party to a County public construction contract (referred to herein generally as the “Contract”) governed by Article 8. Ch. 143 of the General Statutes and identified in G.S. § 143- 128(f1) and who is a party to a dispute arising out of the Contract and the construction process in which the amount in controversy is at least $15,000 may submit a written request to the County for mediation of the dispute. 2. Prior to submission of a written request for mediation to the County, the party requesting mediation should give notice of any and all claims in accordance with their respective contracts, obtain decisions on the claims as required or allowed by their respective contracts, and attempt to resolve the dispute according to the terms and conditions in their respective contracts. The Mediator may adjourn any mediated settlement conference if the Mediator believes, in his or her sole discretion, that the parties have not satisfied all of the terms and conditions of their respective contracts and that doing so will enhance the prospects for a negotiated settlement. C. Condition Precedent to Litigation. Before any party to a Contract may commence a civil action against the County seeking remedies for breach or non-performance of the Contract by the County, said party must first initiate the dispute resolution process under these rules and attend and participate in good faith in the mediated settlement conference. RULE 2. SELECTION OF MEDIATOR A. Mediator Listing. A List of Mediators acceptable to the County is maintained by the County Attorney and that list is incorporated by reference into these Rules. B. Selection of Mediator. The party requesting mediation shall select a Mediator from the List of Mediators and shall file, with the County, a Notice of Selection of Mediator within 21 days of the request for mediation. Such notice shall state the name, address, and phone number of the Mediator selected. If DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 the Mediator selected is not available or declines to participate for any reason, the requesting party shall select another person from the List of Mediators. If the party requesting mediation does not select and designate a mediator within 21 days of the request for mediation, the County shall have the right in its absolute discretion to appoint a mediator from its List of Mediators. C. Disqualification of Mediator. Any party may request replacement of the Mediator for good cause. Nothing in this provision shall preclude Mediators from disqualifying themselves. RULE 3. THE MEDIATED SETTLEMENT CONFERENCE A. Where Conference is to be Held. Unless all parties and the Mediator otherwise agree, the mediated settlement conference shall be held in county seat of Orange County. The Mediator shall be responsible for reserving a place, making arrangements for the conference, and giving timely notice of the time and location of the conference to all attorneys, unrepresented parties and other persons or entities required to attend. B. When Conference is to be Held. The mediation shall be completed within 90 days after selection of the Mediator unless all parties to the mediation agree to a different schedule. C. Request to Accelerate or Extend Deadline for Completion. Any party or the Mediator may request the County to accelerate or extend the deadline for completion of the conference. Such request shall state the reasons the acceleration or extension is sought and shall be served by the moving party upon the other parties and the Mediator. Objections to the request must be promptly communicated to the County and to the Mediator. The County, with the concurrence of the designated Mediator, may grant the request by adjusting the time for completion of the conference. D. Recesses. The Mediator may recess the mediation conference at any time and may set times for reconvening. If the Mediator determines the time and place where the conference is to reconvene before the conference is recessed, no further notice is required to persons present at the conference. E. Project Delay. The mediated settlement conference that results from a construction contract dispute shall not be cause for the delay of the construction project. RULE 4. DUTIES OF PARTIES AND OTHER PARTICIPANTS IN FORMAL DISPUTE RESOLUTION PROCESS A. Attendance. 1. All parties to the dispute must designate an official representative to attend the mediation. 2. “Attendance” means physical attendance, not by telephone or other electronic means. Any attendee representing a party must have authority from that party to bind it to any agreement reached as a result of the mediation. 3. Attorneys representing parties may attend the mediation, but are not required to do so. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 4. Sureties and insurance company representatives are required to physically attend the mediation unless the Mediator and all of the other parties to the mediation excuse their attendance or consent to their attendance by telephone or other electronic means. 5. The parties who attend a duly scheduled mediation conference shall have the right to recover their share of the Mediator’s compensation from any party or parties who fail to attend the conference without good cause. B. Finalizing Agreement. If an agreement is reached in the conference, the terms of the agreement shall be confirmed in writing and signed by all parties. C. Payment of Mediation Fee: Mediation Fees charged by the Mediator shall be paid in accordance with G.S. § 143-128(f1). D. Failure to Compensate Mediator. Any party’s failure to compensate the Mediators in accordance with G.S. § 143-128(f1) shall subject that party to a withholding by the County of said amount of money from the party’s payment or any other moneys owed by that party to the County. Should the County fail to compensate the Mediator, it shall hereby be subject to a civil cause of action from the Mediator for the County’s portion of the Mediator’s total fee as required by G.S. § 143-128(f1). RULE 5. AUTHORITY AND DUTIES OF MEDIATORS A. Authority of Mediator. 1.Control of Conference. The Mediator shall at all times be in control of the conference and the procedures to be followed. 2.Private Consultation. The Mediator may communicate privately with any participant or counsel prior to and during the conference. The fact that private communications have occurred with a participant shall be disclosed to all other participants at the beginning of the conference. 3.Scheduling the Conference. The Mediator shall make a good faith effort to schedule the conference at a time that is convenient with the participants, attorneys and Mediator. In the absence of agreement, the Mediator shall select the date for the conference. 4.Determining good cause for a party’s failure to appear at a scheduled mediation conference. B.Duties of Mediator. 1.The Mediator shall define and describe the following at the beginning of the conference: a.The process of mediation. b.The difference between mediation and other forms of conflict resolution. c.The costs of the mediated settlement conference. d.That the mediated settlement conference is not a trial, the Mediator is not a judge, and the parties retain their legal rights if they do not reach settlement; however, the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 Mediator will advise all parties that failure to appear at mediation without good cause may result in imposition of sanctions and may be asserted as a bar to lawsuits by claimants who have failed to exhaust this administrative remedy. e.The circumstances under which the Mediator may meet and communicate privately with any of the parties or with any other person. f.Whether and under what conditions communications with the Mediator will be held in confidence during the conference. g.The inadmissibility of conduct and statements as provided by G.S. §7A-38.1(1). h.The duties and responsibilities of the Mediator and the participants. i.That any agreement reached will be reached by mutual consent. 2. Disclosure: The Mediator has a duty to be impartial and to advise all participants of any possible bias, prejudice or partiality. 3. Declaring Impasse: The Mediator may determine at any time during the mediation conference that an impasse exists and that the conference should end. 4. Reporting Results of Conference. The Mediator shall submit a written report to the County and the other parties within 10 days of the conference stating whether or not the parties reached an agreement. The Mediator’s report shall indicate the absence of any party from the mediated settlement conference without permission or good cause. 5. Scheduling and Holding the Conference. It is the duty of the Mediator to schedule the conference and conduct it prior to the deadline of completion set by the rules. The Mediator shall strictly observe deadlines for completion of the conference unless said time limit is changed by agreement of the parties. RULE 6. COMPENSATION OF THE MEDIATOR The parties shall compensate the Mediator for mediation services at the rate proposed by the Mediator and agreed to by the parties at the time the Mediator is selected. RULE 7. RULE MAKING These Rules may be amended by the County at any time. Amendments will not affect mediations where claims or requests for mediation have been filed at the time the amendment takes effect . RULE 8. DEFINITIONS A. “County” shall mean Orange County North Carolina. B. “Project Designer” is that person or firm stipulated as project designer in the Contract Documents for the project. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 07/20 C. “Claim” is a demand or assertion by a party seeking adjustment or interpretation of Contract terms, payment of money, extension of time or other relief with respect to the terms of the Contract. The term “Claim” also includes other disputes and matters in question between the parties to a Contract involved in the County’s building construction renovation and repair projects arising out of or relating to the Contract or the construction process. Claims must be initiated by a written notice. The responsibility to substantiate Claims shall rest with the party making the Claim. D. “Good Cause” generally includes any circumstance beyond the control of a party, which prevents that party from meeting obligations. When good cause is asserted as an excuse for a party’s failure to appear at a mediation conference or to otherwise comply with the requirements of these Rules, the Mediator, in his or her sole discretion, will determine whether good cause exists to excuse the party’s failure to appear or otherwise comply with these rules. RULE 9. TIME LIMITS A. Any time limit provided for by these Rules may be waived or extended at the sole discretion of the County, if no Mediator has been selected, and at the discretion of the County with concurrence of the Mediator if a Mediator has been selected. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ADDENDUM #1 PRE-BID MEETING MINUTES SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT ORANGE COUNTY, HILLSBOROUGH, NC BID No. 367-5288 ATLAS PROJECT NO. J2400 MEETING DATE: October 1, 2020 ATTENDEES: Angel Barnes – Orange County Asset Management Services Rob Tatum – Atlas Engineering Gary Kurth – AAR Roofing Will Trute – Allied Roofing Juan Rios – Curtis Construction Nathan Darrah – BAR Roofing and Maintenance Gary Daughtry – CFE, Inc. Chris Brackin – Muter Construction Matthew French – BIRS, Inc. Eddie Lester – B&M Roofing Caleb Smith – Hamlin Roofing Brady Knowles – Owens Roofing, Inc. Will Diachenko – Baker Roofing Jack Brewer – Brewer Scaffold Ryan Walsh – Sarnafil Jim Taylor – Carolina Construction and Restoration A mandatory pre-bid meeting was held at the Orange County Sportsplex located in Hillsborough, North Carolina on October 1, 2020 at 10:00 a.m. to discuss the roof replacement project for the main building of the Sportsplex. Key project team members were introduced. Ms. Angel Barnes is the project manager for Orange County. Mr. Andrew Stock and Mr. John Stock will be the main points of contact for the facility. Mr. Rob Tatum is the Project Manager for Atlas Engineering and will be the primary source of contact for the Designer. The pre-bid meeting is mandatory. Companies that are not listed on the attached sign-in sheet will not be able to bid. All addenda will be e-mailed to eligible bidders. The following documents were not included in the initial distributed bid documents: The Form of Proposal, Form of Bid Bond, Safety Questionnaire for Formal Bids, Sheet for Attachment of Living Wage Certification, Form of Construction Contract, Form of Performance Bond, and Form of Payment Bond. These documents were on the thumb drive distributed at the pre-bid and are each attached to Addendum 1. Submit bids to Orange County Financial/Administrative Services, 405 Meadowlands Drive, Hillsborough, NC 27278 to the attention of Orange County Purchasing. Bids are due on Thursday, October 22, 2020 at 3:00 p.m. Bidders are responsible for delivering the bid to the correct address by the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 specified time. Bids will be publicly opened and read starting at 3:30 p.m. in the Parking Lot at 405 Meadowlands Drive, Hillsborough, NC 27278. Bidders shall include the Form of Proposal, MBE Affidavit A or B, Bid Bond (5%), Contractor’s Safety Record Information, and Living Wage Certification with their bid. The contractor is to use the documents provided in the project manual and Addendum #1. Contractors must have the proper license as required by the State of North Carolina. General Contractors must have license classification for Building. Performance and Payment Bonds will be required for one hundred percent of the contract price. These bonds are not required with the bid, but Bidders must be sure they are able to obtain bonds for the full amount they are bidding. Contractors are to use the documents in the project manual and Addendum #1. The proposal shall be valid for a period of 90 days. The owner reserves the right to reject any or all bids and to waive informalities. The contractors were reminded to read the “Notice to Bidders” and follow all requirements. The contractor will have to meet the insurance requirements. Last day for questions will be by 5:00 p.m. on October 12, 2020 and no addenda will be issued after 5:00 p.m. October 16, 2020. Acknowledge all addenda on the proposal. Contractor will have 60 consecutive calendar days from the Notice to Proceed to complete the project. Liquidated damages will be imposed at a rate of $500 per calendar day beyond the date of Final Acceptance. The contractor is to include the unit quantities in Section 012100, Item 1.03 into their base bid. Fill out “unit prices” on the Form of Proposal. Any unused base bid quantities will be credited back to Orange County through a change order at the end of the project. The contractor is responsible to review the Hot Work Permit Program in the project manual. The contractor is to follow the FM Global Hot Work Permit process and has a minimum of 4 hour fire watch (Includes heat welding membrane seams). Workers will have to complete the FM Global training program and obtain a certificate. Copies of the certificate will be provided to Orange County. All equipment shutdowns have to be approved in writing in advance by the Orange County. A minimum of 72 hour notice before any shut down is required. More advanced notice may be required for the larger pieces of equipment. Section 010100, Item 1.01B was reviewed. The contractor may work Monday through Friday from 6:00 a.m. to 8:00 p.m. Work may occur on the weekends, but prior approval must be obtained from Orange County. Notice of weekend work must be provided by the end of the day on Thursday. The contractor must have prior experience with the materials/systems to be installed, have performed projects of similar size and scope, and shall have been in business a minimum of five years prior to the date of bid. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Submittals are to be provided in PDF format. A Dropbox file can be created for the submittals. Contractor shall provide a foreman or a representative from the Contractor that is in a supervisory position that is familiar with the installation of the new roof system and who will be on the site anytime that work by the Contractor or one of his Subcontractors is in progress. The Contractor must provide a representative that is fluent in English on-site at all times when work is in progress to ensure that the Owner and Designer can communicate with the crew members as needed during construction. The Installers of the single-ply roof system must be approved/certified applicators of the manufacturer systems/products to be installed. The certification/approval must be provided by the manufacturer and must be based on installation training, contractor experience with the system, and installation performance and technical observation, not solely on sales ranking. Approval/certifications must have been in place prior to the bid date. The prime contract shall either be approved themselves, or shall use approved subcontractors to perform the work on this project. The contractor must submit a COVID-19 plan for review and approval prior to beginning work. The Owner will provide water for construction purpose if adequate for use. The contractor will be responsible for power, toilet facilities, and sanitary facilities. The contractor will provide a station for workers to wash their hands with soap and water. Refer to Section 016000, Item 1.03 for substitution requests. Substitution requests must come from an eligible Bidder. Substitutions not in accordance with this section will not be reviewed. Bidders should fully examine the Project Documents and existing site conditions prior to submitting their bid. If there are any questions regarding the design intent, or any errors or discrepancies in the drawings or documents are found, bidders should immediately notify the Designer to allow for correction or clarification in an addendum to all bidders. Addendum #1 will include the pre-bid meeting minutes and provide response to any unanswered questions. Addenda will be sent to each plan holder including eligible bidders, manufacturers, or subcontractors. The person attending the pre-bid meeting will receive such addenda unless a different contact person from that company has been requested. Only the underside of the deck of Roof Area B is to be painted. A mechanical contractor will be used to raise gas and liquid lines. Trademasters Services, Inc. currently services all equipment on the facility and they are familiar with the required scope of work. Contractors may contact Wayne Sheppard at 919-382-3330 (office), 919-730-4457 (cell), or by email at wayne@trademastersnc.com. A 5-Year Contractor’s Warranty is required. Contracts typically take 2 weeks to execute. A walk through on the roof was conducted. END OF ADDENDUM #1 Attachments: Form of Proposal, Form of Bid Bond, Safety Questionnaire for Formal Bids, Sheet for Attachment of Living Wage Certification, Form of Construction Contract, Form of Performance Bond, and Form of Payment Bond DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3URSRVDO)RUP±6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQWRI )2502)352326$/ Sportsplex Main Building Roof Replacement &RQWUDFW Orange County, Hillsborough, NC%LGGHU 'DWH 7KHXQGHUVLJQHGDVELGGHUKHUHE\GHFODUHVWKDWWKHRQO\SHUVRQRUSHUVRQVLQWHUHVWHGLQWKLVSURSRVDODVSULQFLSDORUSULQFLSDOV LVRUDUHQDPHGKHUHLQDQGWKDWQRRWKHUSHUVRQWKDQKHUHLQPHQWLRQHGKDVDQ\LQWHUHVWLQWKLVSURSRVDORULQWKHFRQWUDFWWREH HQWHUHGLQWRWKDWWKLVSURSRVDOLVPDGHZLWKRXWFRQQHFWLRQZLWKDQ\RWKHUSHUVRQFRPSDQ\RUSDUWLHVPDNLQJDELGRUSURSRVDO DQGWKDWLWLVLQDOOUHVSHFWVIDLUDQGLQJRRGIDLWKZLWKRXWFROOXVLRQRUIUDXG7KHELGGHUIXUWKHUGHFODUHVWKDWKHKDVH[DPLQHG WKHVLWHRIWKHZRUNDQGWKHFRQWUDFWGRFXPHQWVUHODWLYHWKHUHWRDQGKDVUHDGDOOVSHFLDOSURYLVLRQVIXUQLVKHGSULRUWRWKHRSHQLQJ RIELGVWKDWKHKDVVDWLVILHGKLPVHOIUHODWLYHWRWKHZRUNWREHSHUIRUPHG7KHELGGHUIXUWKHUGHFODUHVWKDWKHDQGKLV VXEFRQWUDFWRUVKDYHIXOO\FRPSOLHGZLWK1&*6$UWLFOHLQUHJDUGVWR(9HULILFDWLRQDVUHTXLUHGE\6HFWLRQFRI6HVVLRQ /DZFRGLILHGDV1&*HQ6WDWM 7KH%LGGHUSURSRVHVDQGDJUHHVLIWKLVSURSRVDOLVDFFHSWHGWRFRQWUDFWZLWKWKH Orange County, a political subdivision of the State of North Carolina (Orange County) LQWKHIRUPRIFRQWUDFWVSHFLILHGEHORZWRIXUQLVKDOOQHFHVVDU\PDWHULDOVHTXLSPHQWPDFKLQHU\WRROV DSSDUDWXVPHDQVRIWUDQVSRUWDWLRQDQGODERUQHFHVVDU\WRFRPSOHWHWKHFRQVWUXFWLRQRI 6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW LQIXOOLQFRPSOHWHDFFRUGDQFHZLWKWKHSODQVVSHFLILFDWLRQVDQGFRQWUDFWGRFXPHQWVWRWKHIXOODQGHQWLUH VDWLVIDFWLRQRI Orange County and Atlas Engineering, Inc. ZLWKDGHILQLWHXQGHUVWDQGLQJWKDWQRPRQH\ZLOOEHDOORZHGIRUH[WUDZRUNH[FHSWDVVHWIRUWKLQWKH *HQHUDO&RQGLWLRQVDQGWKHFRQWUDFWGRFXPHQWVIRUWKHVXPRI 6,1*/(35,0(&2175$&7 %DVH%LG 'ROODUV *HQHUDO6XEFRQWUDFWRU3OXPELQJ6XEFRQWUDFWRU /LF/LF 0HFKDQLFDO6XEFRQWUDFWRU(OHFWULFDO6XEFRQWUDFWRU /LF/LF *6GUHTXLUHVDOOVLQJOHSULPHELGGHUVWRLGHQWLI\WKHLUVXEFRQWUDFWRUVIRUWKHDERYHVXEGLYLVLRQVRIZRUN$FRQWUDFWRUZKRVHELGLV DFFHSWHGVKDOOQRWVXEVWLWXWHDQ\SHUVRQDVVXEFRQWUDFWRULQWKHSODFHRIWKHVXEFRQWUDFWRUOLVWHGLQWKHRULJLQDOELGH[FHSWLLIWKHOLVWHG VXEFRQWUDFWRU VELGLVODWHUGHWHUPLQHGE\WKHFRQWUDFWRUWREHQRQUHVSRQVLEOHRUQRQUHVSRQVLYHRUWKHOLVWHGVXEFRQWUDFWRUUHIXVHVWRHQWHU LQWRDFRQWUDFWIRUWKHFRPSOHWHSHUIRUPDQFHRIWKHELGZRUNRULLZLWKWKHDSSURYDORIWKHDZDUGLQJDXWKRULW\IRUJRRGFDXVHVKRZQE\WKH FRQWUDFWRU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3URSRVDO)RUP±6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQWRI 81,735,&(6 (VWLPDWHGTXDQWLWLHVIRUHDFKLWHPEHORZDVGHILQHGLQ6HFWLRQ3DUDJUDSK$RIWKH3URMHFW0DQXDOVKDOOEH FRQVLGHUHGWRKDYHDOUHDG\EHHQLQFOXGHGZLWKLQWKHEDVHELGDPRXQWSURSRVHGDERYH7KHXQLWSULFHVSURYLGHGEHORZVKDOOEH DSSOLHGDVDSSURSULDWHWRFRPSXWHWKHWRWDOYDOXHRIFKDQJHVLQWKHVFRSHRIWKHZRUNLQWKHHYHQWWKDWWKHTXDQWLW\RIDFWXDO ZRUNSHUIRUPHGLVPRUHWKDQRUOHVVWKDQWKHHVWLPDWHGTXDQWLW\8QLWSULFHVTXRWHGDQGDFFHSWHGVKDOODSSO\WKURXJKRXWWKH OLIHRIWKHFRQWUDFWH[FHSWDVRWKHUZLVHVSHFLILFDOO\QRWHG8QLWSULFHVVKDOOEHDSSOLHGDVDSSURSULDWHWRFRPSXWHWKHWRWDO YDOXHRIFKDQJHVLQWKHEDVHELGTXDQWLW\RIWKHZRUNDOOLQDFFRUGDQFHZLWKWKHFRQWUDFWGRFXPHQWV *(1(5$/&2175$&7 1R 0HWDO'HFN5HVWRUDWLRQVT.ft.) 8QLW3ULFH 1R 0HWDO'HFN5HSODFHPHQWVTIW 8QLW3ULFH 1R 0HWDO'HFN5HSDLUVTIW 8QLW3ULFH 1R :RRG%ORFNLQJ5HSODFHPHQWEGIW 8QLW3ULFH 1R 3O\ZRRG5HSODFHPHQWVTIW 8QLW3ULFHBBBBBBBBBBBBB 1R ´*\SVXP%RDUGUHSODFHPHQW VTIW 8QLW3ULFHBBBBBBBBBBBBB 1R $GGLWLRQDO:DON7UHDG,QVWDOODWLRQ OQIW 8QLW3ULFHBBBBBBBBBBBB 1R 5XEEHU3DYHUHD 8QLW3ULFHBBBBBBBBBBBB 1R 7DSHUHG,QVXODWLRQEGIW 8QLW3ULFHBBBBBBBBBBBB 7KHELGGHUIXUWKHUSURSRVHVDQGDJUHHVKHUHE\WRFRPPHQFHZRUNXQGHUWKLVFRQWUDFWRQDGDWHWREHVSHFLILHGLQ D ZULWWHQ RUGHU RI WKH GHVLJQHU DQG VKDOO IXOO\ FRPSOHWH DOO ZRUN WKHUHXQGHU ZLWKLQ WKH WLPH VSHFLILHG LQ WKH 6XSSOHPHQWDU\ *HQHUDO &RQGLWLRQV $UWLFOH $SSOLFDEOH OLTXLGDWHG GDPDJHV DPRXQW LV DOVR VWDWHG LQ WKH 6XSSOHPHQWDU\*HQHUDO&RQGLWLRQV$UWLFOH 0,125,7<%86,1(663$57,&,3$7,215(48,5(0(176 Provide with the bid8QGHU*6FWKHXQGHUVLJQHGELGGHUVKDOOLGHQWLI\RQLWVELG,GHQWLILFDWLRQRI 0LQRULW\%XVLQHVV3DUWLFLSDWLRQ)RUPWKHPLQRULW\EXVLQHVVHVWKDWLWZLOOXVHRQWKHSURMHFWZLWKWKHWRWDOGROODU YDOXHRIWKHELGVWKDWZLOOEHSHUIRUPHGE\WKHPLQRULW\EXVLQHVVHV$OVROLVWWKHJRRGIDLWKHIIRUWV$IILGDYLW$ PDGHWRVROLFLWPLQRULW\SDUWLFLSDWLRQLQWKHELGHIIRUW 127($FRQWUDFWRUWKDWSHUIRUPVDOORIWKHZRUNZLWKLWVRZQZRUNIRUFHPD\VXEPLWDQ$IILGDYLW%WRWKDW HIIHFWLQOLHXRI$IILGDYLW$UHTXLUHGDERYH7KH0%3DUWLFLSDWLRQ)RUPPXVWVWLOOEHVXEPLWWHGHYHQLIWKHUHLV ]HURSDUWLFLSDWLRQ After the bid opening7KH2ZQHUZLOOFRQVLGHUDOOELGVDQGDOWHUQDWHVDQGGHWHUPLQHWKHORZHVWUHVSRQVLEOH UHVSRQVLYHELGGHU8SRQQRWLILFDWLRQRIEHLQJWKHDSSDUHQWORZELGGHUWKHELGGHUVKDOOWKHQILOHZLWKLQKRXUVRI WKHQRWLILFDWLRQRIEHLQJWKHDSSDUHQWORZHVWELGGHUWKHIROORZLQJ $Q$IILGDYLW&WKDWLQFOXGHVDGHVFULSWLRQRIWKHSRUWLRQRIZRUNWREHH[HFXWHGE\PLQRULW\EXVLQHVVHV H[SUHVVHGDVDSHUFHQWDJHRIWKHWRWDOFRQWUDFWSULFHZKLFKLVHTXDOWRRUPRUHWKDQWKHJRDOHVWDEOLVKHG 7KLVDIILGDYLWVKDOOJLYHULVHWRWKHSUHVXPSWLRQWKDWWKHELGGHUKDVPDGHWKHUHTXLUHGJRRGIDLWKHIIRUWDQG $IILGDYLW'LVQRWQHFHVVDU\ 25 ,IOHVVWKDQWKHJRDO$IILGDYLW'RILWVJRRGIDLWKHIIRUWWRPHHWWKHJRDOVKDOOEHSURYLGHG7KHGRFXPHQW PXVWLQFOXGHHYLGHQFHRIDOOJRRGIDLWKHIIRUWVWKDWZHUHLPSOHPHQWHGLQFOXGLQJDQ\DGYHUWLVHPHQWVVROLFLWDWLRQV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3URSRVDO)RUP±6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQWRI DQGRWKHUVSHFLILFDFWLRQVGHPRQVWUDWLQJUHFUXLWPHQWDQGVHOHFWLRQRIPLQRULW\EXVLQHVVHVIRUSDUWLFLSDWLRQLQWKH FRQWUDFW 1RWH%LGGHUVPXVWDOZD\VVXEPLWZLWKWKHLUELGWKH,GHQWLILFDWLRQRI0LQRULW\%XVLQHVV3DUWLFLSDWLRQ)RUPOLVWLQJ DOO0%FRQWUDFWRUVYHQGRUVDQGVXSSOLHUVWKDWZLOOEHXVHG,IWKHUHLVQR0%SDUWLFLSDWLRQWKHQHQWHUQRQHRU ]HURRQWKHIRUP$IILGDYLW$RU$IILGDYLW%DVDSSOLFDEOHDOVRPXVWEHVXEPLWWHGZLWKWKHELG)DLOXUHWRILOHD UHTXLUHGDIILGDYLWRUGRFXPHQWDWLRQZLWKWKHELGRUDIWHUEHLQJQRWLILHGDSSDUHQWORZELGGHULVJURXQGVIRUUHMHFWLRQ RIWKHELG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3URSRVDO)RUP±6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQWRI 3URSRVDO6LJQDWXUH3DJH 7KHXQGHUVLJQHGIXUWKHUDJUHHVWKDWLQWKHFDVHRIIDLOXUHRQKLVSDUWWRH[HFXWHWKHVDLGFRQWUDFWDQGWKHERQGV ZLWKLQWHQFRQVHFXWLYHFDOHQGDUGD\VDIWHUEHLQJJLYHQZULWWHQQRWLFHRIWKHDZDUGRIFRQWUDFWWKHFHUWLILHG FKHFNFDVKRUELGERQGDFFRPSDQ\LQJWKLVELGVKDOOEHSDLGLQWRWKHIXQGVRIWKHRZQHU VDFFRXQWVHWDVLGHIRUWKH SURMHFWDVOLTXLGDWHGGDPDJHVIRUVXFKIDLOXUHRWKHUZLVHWKHFHUWLILHGFKHFNFDVKRUELGERQGDFFRPSDQ\LQJWKLV SURSRVDOVKDOOEHUHWXUQHGWRWKHXQGHUVLJQHG 5HVSHFWIXOO\VXEPLWWHGWKLVGD\RI 1DPHRIILUPRUFRUSRUDWLRQPDNLQJELG :,71(66%\ 6LJQDWXUH 1DPH 3URSULHWRUVKLSRU3DUWQHUVKLS3ULQWRUW\SH 7LWOHBBBBBBBBBBBBBB 2ZQHU3DUWQHU3UHV93UHV $GGUHVV $77(67 %\/LFHQVH1R 7LWOH)HGHUDO,'1R &RUS6HFRU$VVW6HFRQO\ (PDLO$GGUHVV &25325$7(6($/ $GGHQGXPUHFHLYHGDQGXVHGLQFRPSXWLQJELG $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R $GGHQGXP1R DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 )2502)%,'%21' .12: $// 0(1 %< 7+(6( 35(6(176 7+$7 BBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB DV SULQFLSDODQGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBDVVXUHW\ZKRLV GXO\OLFHQVHGWRDFWDVVXUHW\LQ1RUWK&DUROLQDDUHKHOGDQGILUPO\ERXQGXQWR2UDQJH &RXQW\DSROLWLFDOVXEGLYLVLRQRIWKH6WDWHRI1RUWK&DUROLQDWKURXJKDVREOLJHHLQWKH SHQDO VXP RI BBBBBBBBBBBBBBBBBBBBBBBBBBB '2//$56 ODZIXO PRQH\RI WKH 8QLWHG 6WDWHVRI$PHULFDIRUWKHSD\PHQWRIZKLFKZHOODQGWUXO\WREHPDGHZHELQGRXUVHOYHV RXUKHLUVH[HFXWRUVDGPLQLVWUDWRUVVXFFHVVRUVDQGDVVLJQVMRLQWO\DQGVHYHUDOO\ILUPO\E\ WKHVHSUHVHQWV 6LJQHGVHDOHGDQGGDWHGWKLV GD\RI :+(5($6WKHVDLGSULQFLSDOLVKHUHZLWKVXEPLWWLQJSURSRVDOIRU DQGWKHSULQFLSDOGHVLUHVWRILOHWKLVELGERQGLQOLHXRIPDNLQJ WKHFDVKGHSRVLWDVUHTXLUHGE\*6 12:7+(5()25(7+(&21',7,212)7+($%29(2%/,*$7,21LVVXFKWKDW LI WKH SULQFLSDO VKDOO EH DZDUGHG WKH FRQWUDFW IRU ZKLFK WKH ELG LV VXEPLWWHG DQG VKDOO H[HFXWHWKHFRQWUDFWDQGJLYHERQGIRUWKHIDLWKIXOSHUIRUPDQFHWKHUHRIZLWKLQWHQGD\VDIWHU WKHDZDUGRIVDPHWRWKHSULQFLSDOWKHQWKLVREOLJDWLRQVKDOOEHQXOODQGYRLGEXWLIWKH SULQFLSDOIDLOVWRVRH[HFXWHVXFKFRQWUDFWDQGJLYHSHUIRUPDQFHERQGDVUHTXLUHGE\*6 WKHVXUHW\VKDOOXSRQGHPDQGIRUWKZLWKSD\WRWKHREOLJHHWKHDPRXQWVHWIRUWKLQ WKHILUVWSDUDJUDSKKHUHRI3URYLGHGIXUWKHUWKDWWKHELGPD\EHZLWKGUDZQDVSURYLGHGE\ *6 6($/ 6($/ 6($/ 6($/ 6($/ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &RQWUDFWRU¶V6DIHW\5HFRUG,QIRUPDWLRQ 7KH&RQWUDFWRU¶VVDIHW\UHFRUGVKDOOEHUHYLHZHGDQGHYDOXDWHGLQDGGLWLRQWRRWKHUTXDOLW\DQG SHUIRUPDQFHFULWHULDDVSDUWRIELGHYDOXDWLRQSURFHVV)DLOXUHWRSURYLGHWKHUHTXHVWHG LQIRUPDWLRQDQGGRFXPHQWDWLRQPD\UHVXOWLQUHMHFWLRQRI\RXUELGDVQRQUHVSRQVLYH $FFRUGLQJO\DOOELGGHUVPXVWVXEPLWWKHIROORZLQJLQIRUPDWLRQUHJDUGLQJWKHLUVDIHW\UHFRUG 7KHIROORZLQJGHILQLWLRQVVKDOODSSO\WRWKLVVHFWLRQ ³'$57LQFLGHQWUDWH´±$FURQ\PIRU³'D\V$ZD\5HVWULFWLRQVDQG7UDQVIHUV´7KH '$57LQFLGHQWUDWHPD\EHXVHGWRVKRZWKHUHODWLYHOHYHORILQMXULHVDQGLOOQHVVHVZLWKLQ DILUPFRPSDUHGWRWKHLQGXVWU\,WLVEDVHGRQO\RQWKRVHLQMXULHVDQGLOOQHVVHVVHYHUH HQRXJKWRZDUUDQW³'D\V$ZD\5HVWULFWLRQVDQG7UDQVIHUV´7KH'$57LQFLGHQWUDWHLV FDOFXODWHGXVLQJ26+$¶V)RUPDQGWKHIROORZLQJIRUPXOD 1XPEHURIHQWULHVLQFROXPQ+GD\VDZD\IURPZRUNFROXPQ,MREWUDQVIHURU UHVWULFWLRQ[1XPEHURIKRXUVZRUNHGE\DOOHPSOR\HHV '$57,QFLGHQW UDWH ³(05´±$FURQ\PIRU³([SHULHQFH0RGLILFDWLRQ5DWH´LVDQLQGLFDWRURIDFRQWUDFWRU¶V SDVWVDIHW\SHUIRUPDQFHZLGHO\XVHGE\WKHLQVXUDQFHLQGXVWU\DVDQHTXLWDEOHPHDQVRI GHWHUPLQLQJSUHPLXPVIRUZRUNHUV FRPSHQVDWLRQLQVXUDQFH7KHUDWLQJV\VWHPFRQVLGHUV WKHDYHUDJHZRUNHUV FRPSHQVDWLRQORVVHVIRUDJLYHQILUP VW\SHRIZRUNDQGDPRXQWRI SD\UROODQGSUHGLFWVWKHGROODUDPRXQWRIH[SHFWHGORVVHVWREHSDLGE\WKDWHPSOR\HULQD GHVLJQDWHGUDWLQJSHULRGXVXDOO\WKUHH\HDUV7KHUDWLQJLVEDVHGRQFRPSDULVRQRIILUPV GRLQJVLPLODUW\SHVRIZRUNDQGWKHHPSOR\HULVUDWHGDJDLQVWWKHDYHUDJHH[SHFWHG SHUIRUPDQFHLQHDFKZRUNFODVVLILFDWLRQ/RVVHVLQFXUUHGE\WKHHPSOR\HUIRUWKHUDWLQJ SHULRGDUHWKHQFRPSDUHGWRWKHH[SHFWHGORVVHVWRGHYHORSDQH[SHULHQFHUDWLQJ ³26+$´±$FURQ\PIRUWKH)HGHUDO2FFXSDWLRQDO+HDOWKDQG6DIHW\$GPLQLVWUDWLRQ 7KHWHUP³26+$´DVXVHGLQWKLV3ROLF\DOVRUHIHUVWRDQ\VWDWHRUORFDODJHQF\KDYLQJ MXULVGLFWLRQDODXWKRUL]DWLRQWRHQIRUFHZRUNHUVDIHW\UHTXLUHPHQWVDQGDVVHVVILQHVRU ZDUQLQJVIRUYLRODWLRQRIZRUNHUVDIHW\VWDQGDUGV 26+$'$57,QFLGHQW5DWH3URYLGHWKHELGGHU¶V'$57,QFLGHQW5DWH FDOFXODWHGIURP26+$¶V)RUPIRUWKHODVWWKUHH\HDUVDQGWKHRWKHUUHTXLUHG LQIRUPDWLRQVKRZQLQWKHH[DPSOHWDEOHEHORZ7KHELGGHUPXVWDWWDFKDOOVXSSRUWLQJ GRFXPHQWDWLRQDQGFDOFXODWLRQVLQFOXGLQJFHUWLILHG26+$IRUPV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 <($5&2175$&725 '$57 ,1&,'(175$7( ,1'8675< '$57 ,1&,'(175$7( ,1'8675<),(/'$1'&2'( ([SHULHQFH0RGLILFDWLRQ5DWH(053URYLGHWKHELGGHU¶VPRVWUHFHQW ([SHULHQFH0RGLILFDWLRQ5DWH(05EDVHGRQLQVXUDQFHFODLPVKLVWRU\7KHELGGHU PXVWSURYLGHWKHVRXUFHRIWKH(05LQIRUPDWLRQDQGFRQWDFWLQIRUPDWLRQRILQVXUHUHQWLW\ SURYLGLQJWKH(05 <($5&2175$&725 (05 ,1'8675<),(/'$1' &2'( 1$0($1'&217$&7 ,1)2)25(05 ,1)250$7,21 $QVZHUWKHIROORZLQJ26+$6SHFLILF4XHVWLRQV D :LWKLQWKHODVW\HDUVKDVWKHELGGHUUHFHLYHGDQ\FLWDWLRQVFODVVLILHGE\ 26+$DVEHLQJVHULRXVZLOOIXODQGRUUHSHDWYLRODWLRQVZKHUH\RXU FRPSDQ\RSHUDWHV" <HVBBBBB1RBBBBBBBB ,I\HVDWWDFKDFRS\RIHDFKVXFKFLWDWLRQDQGYLRODWLRQ E +DVWKHELGGHUH[SHULHQFHGDQ\ZRUNUHODWHGIDWDOLWLHVZLWKLQWKHODVWILYH \HDUV" <HVBBBBBB1RBBBBBB DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 F +DVWKHELGGHUKDGDQ\FLWDWLRQVLVVXHGE\26+$DVDUHVXOWRIZRUN UHODWHGIDWDOLWLHVZLWKLQWKHSDVW\HDUV" <HVBBBBBB1RBBBBBB G ,VWKHELGGHUXQGHULQYHVWLJDWLRQIRUDQ\ZRUNUHODWHGIDWDOLWLHV" <HVBBBBBB1RBBBBBB H,I\RXUDQVZHULV³\HV´WREFRUGSURYLGHDFRS\RIWKHFLWDWLRQV OLVWRIQXPEHUVRIIDWDOLWLHVDQGGRFXPHQWHGH[SODQDWLRQRIWKHIDWDOLW\ 6DIHW\3ODQ D 'RHVWKHFRPSDQ\KDYHDZULWWHQVDIHW\SURJUDPWKDWLQFOXGHV UHVSRQVLELOLW\IRUDOODVSHFWVRIVDIHW\PDQDJHPHQW" <HVBBBBBBBBB1RBBBBBBB E 'RHVWKHFRPSDQ\KDYHDZULWWHQSODQIRUVDIHW\WUDLQLQJRIQHZ HPSOR\HHVDQGRQJRLQJWUDLQLQJRIH[LVWLQJHPSOR\HHV" <HVBBBBBBBBB1RBBBBBBB F 'RHVWKHFRPSDQ\KDYHGRFXPHQWHGHYLGHQFHRIVDIHW\WUDLQLQJWKDWWKH\ KDYHFRQGXFWHG" <HVBBBBBBBBB1RBBBBBBB G ,IWKHFRPSDQ\KDVHPSOR\HHVZLWKOLPLWHG(QJOLVKDELOLW\GRHVWKH FRPSDQ\KDYHDZULWWHQSODQIRUHQVXULQJWKDWWKHLUHPSOR\HHVXQGHUVWDQGWKH WUDLQLQJWKH\DUHEHLQJJLYHQ" <HVBBBBBBBBB1RBBBBBBB H'RDOOVXSHUYLVRUVKDYHDQDSSURSULDWHGRFXPHQWHGOHYHORI26+$WUDLQLQJ HJDPLQLPXPRIKRXU26+$FRQVWUXFWLRQVDIHW\WUDLQLQJ" <HVBBBBBBBBB1RBBBBBBB DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 I'RHPSOR\HHVKDYHGRFXPHQWHGEDVLF26+$KRXUFRQVWUXFWLRQVDIHW\ WUDLQLQJ" <HVBBBBBBBBB1RBBBBBBB J'RHVWKHFRPSDQ\KDYHDGRFXPHQWHG+D]DUG&RPPXQLFDWLRQ3URJUDP" <HVBBBBBBBBB1RBBBBBBB 5HTXLUHG:ULWWHQ([SODQDWLRQRI6DIHW\5HFRUG,IWKHELGGHUKDVDQ\RIWKHIROORZLQJ D'$57LQFLGHQWUDWHJUHDWHUWKDQLWVLQGXVWU\DYHUDJHEDQ(05JUHDWHUWKDQF DQVZHUHG³\HV´WRDQ\RIWKH26+$6SHFLILF4XHVWLRQDERYHRUGDQVZHUHG³QR´WRDQ\RIWKH 6DIHW\3ODQTXHVWLRQVWKHELGGHUVKDOOSURYLGHWKH&RXQW\LQLWVELGDGHWDLOHGZULWWHQ H[SODQDWLRQRILWVVDIHW\UHFRUGDQGWKHUHDVRQVZK\VXFKVDIHW\KLVWRU\LV127UHSUHVHQWDWLYHRI LWVIXWXUHSHUIRUPDQFHDQGZKDWVSHFLILFDFWLRQVLWKDVWDNHQWRLPSURYHLWVRYHUDOOVDIHW\UHFRUG )DLOXUHWRSURYLGHDZULWWHQH[SODQDWLRQRILWVVDIHW\UHFRUGSXUVXDQWWRWKLVSDUDJUDSKPD\EH GHHPHGDVQRQUHVSRQVLYHE\WKH&RXQW\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 6KHHWIRU$WWDFKLQJ/LYLQJ:DJH&HUWLILFDWLRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 1 >'HSDUWPHQWDO8VH2QO\@ 7,7/( )< 1257+&$52/,1$ &216758&7,21$*5((0(1729(5 25$1*(&2817< 7+,6&216758&7,21$*5((0(17KHUHLQDIWHUFDOOHG³$JUHHPHQW´PDGHDVRIWKHGD\ RIE\DQGEHWZHHQKHUHLQDIWHUFDOOHGWKH ³&RQWUDFWRU´ DQG 2UDQJH &RXQW\ D SROLWLFDOVXEGLYLVLRQRIWKH6WDWHRI1RUWK&DUROLQDKHUHLQDIWHUFDOOHGWKH³&RXQW\´³2UDQJH&RXQW\´RU ³2ZQHU´ :,71(66(7+ 7KDWWKH&RQWUDFWRUDQGWKH2ZQHUIRUWKHFRQVLGHUDWLRQKHUHLQQDPHGDJUHHDVIROORZV &2175$&7'2&80(17635,25,7< 7KH &RQWUDFW 'RFXPHQWV FRQVLVW RI WKLV $JUHHPHQW WKH *HQHUDO &RQGLWLRQV ZKLFK DUH IXOO\ LQFRUSRUDWHGLQWKLV$JUHHPHQWWKH5HTXHVWIRU3URSRVDOVGHVLJQHUDSSURYHGFRPPXQLFDWLRQVDQGRUILHOG RUGHUV WKH 3URSRVDO &RQVWUXFWLRQ 'RFXPHQWV DQG 'UDZLQJV DQG :ULWWHQ 6SHFLILFDWLRQV 7KH &RQWUDFW 'RFXPHQWVIRUPWKH&RQWUDFW,QWKHHYHQWRIDQ\LQFRQVLVWHQF\EHWZHHQRUDPRQJWKH&RQWUDFW'RFXPHQWV WKH&RQWUDFW'RFXPHQWVVKDOOEHLQWHUSUHWHGLQWKHIROORZLQJRUGHURISULRULW\ D7KLV$JUHHPHQWDQGLQFRUSRUDWHG*HQHUDO&RQGLWLRQVDWWDFKHGDV([KLELW E'HVLJQHU DSSURYHG DQG VWDPSHG FRQVWUXFWLRQ GRFXPHQWV DQG GUDZLQJV DQG ZULWWHQ VSHFLILFDWLRQV F'HVLJQHUDSSURYHGFRPPXQLFDWLRQVDQGRUILHOGRUGHUV G5HTXHVWIRU3URSRVDOVDQGDGGHQGDWKHUHWR H3URSRVDO 6&23(2):25. 7KH&RQWUDFWRUVKDOOIXUQLVKDQGGHOLYHUDOORIWKHPDWHULDOVDQGSHUIRUPDQGEHIXOO\UHVSRQVLEOH IRUDOORIWKH:RUNUHTXLUHGE\WKLV$JUHHPHQWZLWKLQWKHWLPHSHULRGVWLSXODWHGLQDZULWWHQ1RWLFHWR3URFHHG WREHH[HFXWHGE\WKH&RQWUDFWRUDQG2ZQHUDQGLQDFFRUGDQFHZLWKWKHIROORZLQJHQXPHUDWHGGRFXPHQWV ZKLFKDUHPDGHDSDUWKHUHRIDVLIIXOO\FRQWDLQHGKHUHLQ D&RQVWUXFWLRQ'UDZLQJVSUHSDUHGE\ 6KHHWGDWHG E:ULWWHQVSHFLILFDWLRQVSUHSDUHGE\WKH'HVLJQHU FSURSRVDOGDWHGZKLFKIXOO\GHVFULEHVWKHZRUNWREHSHUIRUPHGVXFK ZRUNKHUHLQDIWHUFDOOHGWKH³:RUN´ $250,000 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 2 G5HODWHGGRFXPHQWVOLVWHGXQGHU6HFWLRQDERYH 7(50$1'6&+('8/,1* D7KH&RQWUDFWRUDJUHHVWRFRPPHQFHZRUNSXUVXDQWWRWKHZULWWHQ1RWLFHWR3URFHHG E7KH&RQWUDFWRUDJUHHVWRFRPSOHWHVXEVWDQWLDOO\DOO:RUNLQFOXGHGE\ F7LPH LV RI WKH HVVHQFH ZLWK UHVSHFW WR DOO GDWHV VSHFLILHG LQ WKH &RQWUDFW 'RFXPHQWV DV &RPSOHWLRQ'DWHV G7KH&RQWUDFWRUVKDOOSHUIRUPWKH:RUNLQWKHWLPHPDQQHUDQGIRUPUHTXLUHGE\WKH&RQWUDFW 'RFXPHQWVDQGDVVWLSXODWHGLQDZULWWHQ1RWLFHWR3URFHHGWREHH[HFXWHGE\WKH&RQWUDFWRU DQG2ZQHU 67$1'$5'2)&$5($1''87,(62)&2175$&725 D7KH &RQWUDFWRU VKDOO H[HUFLVH UHDVRQDEOH FDUH DQG GLOLJHQFH LQSHUIRUPLQJ WKH :RUN LQ DFFRUGDQFHZLWKWKHJHQHUDOO\DFFHSWHGVWDQGDUGVRIWKLVW\SHRI&RQWUDFWRUSUDFWLFHWKURXJKRXW WKH 8QLWHG 6WDWHV DQG LQ DFFRUGDQFH ZLWK DSSOLFDEOH IHGHUDO VWDWH DQG ORFDO ODZV DQG UHJXODWLRQVDSSOLFDEOHWRWKHSHUIRUPDQFHRIWKHVHVHUYLFHV&RQWUDFWRULVVROHO\UHVSRQVLEOH IRUWKHSURIHVVLRQDOTXDOLW\DFFXUDF\DQGWLPHO\FRPSOHWLRQDQGRUVXEPLVVLRQRIDOOZRUN E7KH&RQWUDFWRUVKDOOQRWORDGRUSHUPLWDQ\SDUWRIWKH:RUNWREHORDGHGZLWKDZHLJKWWKDW ZLOOHQGDQJHULWVVDIHW\LQWHQGHGSHUIRUPDQFHRUFRQILJXUDWLRQ F&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOO&RQWUDFWRU6XEFRQWUDFWRUDQG6XEVXEFRQWUDFWRUHUURUV RURPLVVLRQVLQWKHSHUIRUPDQFHRIWKH$JUHHPHQWWRJHWKHUZLWKWKHHUURUVDQGRPLVVLRQVRI DQ\ DJHQW RU HPSOR\HH RI WKH &RQWUDFWRU RU DQ\ 6XEFRQWUDFWRU RU 6XEVXEFRQWUDFWRU &RQWUDFWRUVKDOOFRUUHFWDQ\DQGDOOHUURUVRPLVVLRQVGLVFUHSDQFLHVDPELJXLWLHVPLVWDNHVRU FRQIOLFWVDWQRDGGLWLRQDOFRVWWRWKH2ZQHU G&RQWUDFWRULVDQLQGHSHQGHQWFRQWUDFWRURI2ZQHU$Q\DQGDOOHPSOR\HHVRIWKH&RQWUDFWRU HQJDJHG E\ WKH &RQWUDFWRU LQ WKH SHUIRUPDQFH RI DQ\ ZRUN RU VHUYLFHV UHTXLUHG RI WKH &RQWUDFWRUXQGHUWKLV$JUHHPHQWVKDOOEHFRQVLGHUHGHPSOR\HHVRUDJHQWVRIWKH&RQWUDFWRU RQO\DQGQRWRIWKH2ZQHUDQGDQ\DQGDOOFODLPVWKDWPD\RUPLJKWDULVHXQGHUDQ\ZRUNHUV FRPSHQVDWLRQRURWKHUODZRUFRQWUDFWRQEHKDOIRIVDLGHPSOR\HHVZKLOHVRHQJDJHGVKDOOEH WKHVROHREOLJDWLRQDQGUHVSRQVLELOLW\RIWKH&RQWUDFWRU H&RQWUDFWRUVKDOODWDOOWLPHVUHPDLQLQFRPSOLDQFHZLWKDOODSSOLFDEOHORFDOVWDWHDQGIHGHUDO ODZVUXOHVDQGUHJXODWLRQVLQFOXGLQJEXWQRWOLPLWHGWRDOOVWDWHDQGIHGHUDOQRQGLVFULPLQDWLRQ ODZVSROLFLHVUXOHVDQGUHJXODWLRQVDQGWKH2UDQJH&RXQW\1RQ'LVFULPLQDWLRQ3ROLF\DQG 2UDQJH&RXQW\/LYLQJ:DJH3ROLF\HDFKSROLF\LVLQFRUSRUDWHGKHUHLQE\UHIHUHQFHDQGPD\ EHYLHZHGDWKWWSZZZRUDQJHFRXQW\QFJRYGHSDUWPHQWVSXUFKDVLQJBGLYLVLRQFRQWUDFWVSKS $Q\YLRODWLRQRIWKH2UDQJH&RXQW\1RQ'LVFULPLQDWLRQ3ROLF\LVDEUHDFKRIWKLV$JUHHPHQW DQG&RXQW\PD\LPPHGLDWHO\WHUPLQDWHWKLV$JUHHPHQWZLWKRXWIXUWKHUREOLJDWLRQRQWKHSDUW RIWKH&RXQW\7KLVSDUDJUDSKLVQRWLQWHQGHGWROLPLWDQGGRHVQRWOLPLWWKHGHILQLWLRQRI EUHDFKWRGLVFULPLQDWLRQ I,I DFWLYLWLHV UHODWHG WR WKH SHUIRUPDQFH RI WKLV $JUHHPHQW UHTXLUH VSHFLILF OLFHQVHV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 3 FHUWLILFDWLRQVRUUHODWHGFUHGHQWLDOV&RQWUDFWRUUHSUHVHQWVWKDWLWDQGRULWVHPSOR\HHVDJHQWV DQG VXEFRQWUDFWRUV HQJDJHG LQ VXFK DFWLYLWLHV SRVVHVV VXFK OLFHQVHV FHUWLILFDWLRQV RU FUHGHQWLDOVDQGWKDWVXFKOLFHQVHVFHUWLILFDWLRQVRUFUHGHQWLDOVDUHFXUUHQWDFWLYHDQGQRWLQD VWDWHRIVXVSHQVLRQRUUHYRFDWLRQ J7KH&RQWUDFWRUVKDOOVXSHUYLVHDQGGLUHFWWKH:RUNHIILFLHQWO\DQGZLWKWKH&RQWUDFWRU¶VEHVW VNLOODQGDWWHQWLRQ([FHSWDVVSHFLILFDOO\VHWIRUWKLQWKH&RQWUDFW'RFXPHQWVWKH&RQWUDFWRU VKDOOEHVROHO\UHVSRQVLEOHIRUWKHPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRI FRQVWUXFWLRQ DQG IRU VDIHW\ SUHFDXWLRQV DQG SURJUDPV LQ FRQQHFWLRQ ZLWK WKH :RUN 7KH &RQWUDFWRUVKDOOEHUHVSRQVLEOHWRVHHWKDWWKHILQLVKHG:RUNFRPSOLHVDFFXUDWHO\ZLWKWKH &RQWUDFW'RFXPHQWV K7KH&RQWUDFWRUVKDOODSSRLQWDFRPSHWHQW3URMHFW0DQDJHUZLWKJHQHUDODXWKRULW\WRPDQDJH WKH3URMHFWIRUWKH&RQWUDFWRU7KH&RQWUDFWRUVKDOODOVRNHHSRQWKH3URMHFWDWDOOWLPHVGXULQJ WKH:RUNRIWKH&RQWUDFWRUDFRPSHWHQW5HVLGHQW6XSHULQWHQGHQWDQGQHFHVVDU\DVVLVWDQWVZKR VKDOOQRWEHUHSODFHGZLWKRXWSULRUZULWWHQDSSURYDOE\WKH'HVLJQHURUE\WKH2ZQHULID 'HVLJQHULVQRWUHWDLQHGIRUWKH3URMHFW L,ILQWKHRSLQLRQRIWKH'HVLJQHUDQ\6XEFRQWUDFWRURQWKH3URMHFWLVLQFRPSHWHQWRURWKHUZLVH XQVDWLVIDFWRU\VXFK6XEFRQWUDFWRUVKDOOEHUHSODFHGE\WKH&RQWUDFWRUZLWKQRLQFUHDVHLQWKH &RQWUDFW3ULFHLIDQGZKHQGLUHFWHGE\WKH'HVLJQHU M7KH&RQWUDFWRUVKDOODWWHQGDOOSURJUHVVFRQIHUHQFHVDQGDOORWKHUPHHWLQJVRUFRQIHUHQFHV 7KH&RQWUDFWRUVKDOOEHUHSUHVHQWHGDWWKHVHSURJUHVVFRQIHUHQFHVE\DUHSUHVHQWDWLYHKDYLQJ WKHDXWKRULW\RIWKH3URMHFW0DQDJHUDQGE\VXFKRWKHUUHSUHVHQWDWLYHVDVWKH'HVLJQHUPD\ GLUHFW N&RVWVDQGH[SHQVHVRISURYLGLQJVDPSOHVIRUDQGDVVLVWDQFHLQDQ\WHVWLQJVKDOOEHERUQHE\WKH &RQWUDFWRU $Q\ :RUN LQ ZKLFK XQWHVWHG PDWHULDOV DUH XVHG ZLWKRXW DSSURYDO RU ZULWWHQ SHUPLVVLRQ RI WKH 2ZQHU DQGRU 'HVLJQHU VKDOO EH UHPRYHG DQG UHSODFHG DW &RQWUDFWRU¶V H[SHQVH O7KH&RQWUDFWRUVKDOOREWDLQDOOQHFHVVDU\SHUPLWVLQFOXGLQJDOOSHUPLWVUHTXLUHGWRFRPSOHWHWKH :RUNLQFRPSOLDQFHZLWKORFDOVWDWHDQGRUIHGHUDOODZ 3$<0(17 7$;(6 D7KH 2ZQHU KHUHE\ DJUHHV WR SD\ WR WKH &RQWUDFWRU IRU WKH IDLWKIXO SHUIRUPDQFH RI WKLV $JUHHPHQWDQGWKH&RQWUDFWRUKHUHE\DJUHHVWRSHUIRUPDOORIWKH:RUNIRUDVXPQRWWR H[FHHG'ROODUV1RWODWHUWKDQWKHILIWKWKGD\RIHDFKFDOHQGDUPRQWKWKH &RQWUDFWRUVKDOOVXEPLWWRWKH2ZQHU¶V5HSUHVHQWDWLYHJHQHUDOO\WKH'HVLJQHULID'HVLJQHULV UHWDLQHGRQWKH:RUND5HTXHVWIRU3D\PHQWIRUZRUNGRQHGXULQJWKHSUHYLRXVFDOHQGDU PRQWK L7KH5HTXHVWIRU3D\PHQWVKDOOEHLQIRUPRIDVWDQGDUGL]HGLQYRLFHRU$,$'RFXPHQW *DSSURSULDWHO\DGGUHVVHGWR2ZQHU¶V5HSUHVHQWDWLYHDWDQGVKDOOVKRZ VXEVWDQWLDOO\WKHYDOXHRIZRUNGRQHGXULQJWKHSUHYLRXVFDOHQGDUPRQWK LL7KHDPRXQWGXHIRUSD\PHQWVKDOOEHQLQHW\ILYHSHUFHQWRIWKHYDOXHRIZRUN FRPSOHWHGVLQFHWKHODVW5HTXHVWIRU3D\PHQWDQGWKLVDPRXQWVKDOOEHSDLGE\WKH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 4 2ZQHURQRUEHIRUHWKHODVWEXVLQHVVGD\RIWKHPRQWK2ZQHUVKDOOUHWDLQILYHSHUFHQW WKH³5HWDLQDJH´ 8SRQ2ZQHU¶V5HSUHVHQWDWLYH¶VFHUWLILFDWLRQWKDWILIW\SHUFHQWRIWKH :RUNKDVEHHQVDWLVIDFWRULO\FRPSOHWHG5HWDLQDJHVKDOOEHUHGXFHGWRWZRDQG RQHKDOISHUFHQWò 8SRQ2ZQHU¶V5HSUHVHQWDWLYH¶VFHUWLILFDWLRQWKDWQLQHW\SHUFHQWRIWKH :RUN KDV EHHQ VDWLVIDFWRULO\ FRPSOHWHG 5HWDLQDJH PD\ EH GLVFRQWLQXHG 5HWDLQDJH PD\ EH GLVFRQWLQXHG DW 2ZQHU¶V 'LVFUHWLRQ VR ORQJ DV ZRUN FRQWLQXHVWREHFRPSOHWHGVDWLVIDFWRULO\DQGRQVFKHGXOH LLL)LQDO SD\PHQW VKDOO QRW EH GXH WR WKH &RQWUDFWRU XQWLO WKLUW\ GD\V DIWHU )LQDO &RPSOHWLRQ RI WKH :RUN LQFOXGLQJ SXQFK OLVW ZRUN KDV EHHQ VDWLVIDFWRULO\ DV GHWHUPLQHGE\WKH&RXQW\FRPSOHWHGDQGDQDSSURSULDWH$IILGDYLW,QGHPQLILFDWLRQ DQG5HOHDVHDVUHTXLUHGLQ6HFWLRQGEHORZKDVEHHQUHFHLYHGE\2ZQHU E6KRXOG2ZQHUUHDVRQDEO\GHWHUPLQHWKDW&RQWUDFWRUKDVIDLOHGWRSHUIRUPWKH:RUNUHODWHGWR D5HTXHVWIRU3D\PHQW2ZQHUDWLWVGLVFUHWLRQPD\SURYLGHWKH&RQWUDFWRUWHQGD\VWR FXUHWKHEUHDFK2ZQHUPD\ZLWKKROGWKHDFFRPSDQ\LQJSD\PHQWZLWKRXWSHQDOW\XQWLOVXFK WLPHDV&RQWUDFWRUFXUHVWKHEUHDFK L6KRXOG&RQWUDFWRURULWVUHSUHVHQWDWLYHVIDLOWRFXUHWKHEUHDFKZLWKLQWHQGD\VRU IDLOWRUHDVRQDEO\DJUHHWRVXFKPRGLILHGVFKHGXOH2ZQHUPD\LPPHGLDWHO\WHUPLQDWH WKLV $JUHHPHQW LQ ZULWLQJ ZLWKRXW SHQDOW\ RU LQFXUULQJ IXUWKHU REOLJDWLRQ WR &RQWUDFWRU LL7KLVVHFWLRQVKDOOQRWEHLQWHUSUHWHGWROLPLWWKHGHILQLWLRQRIEUHDFKWRWKHIDLOXUHWR SHUIRUPWKH:RUNUHODWHGWRD5HTXHVWIRU3D\PHQW F7KH&RQWUDFWRUKDVLQFOXGHGLQWKH&RQWUDFW3ULFHDQGVKDOOSD\DOOWD[HVDVVHVVHGE\DQ\ DXWKRULW\RQWKH:RUNRUWKHODERUDQGPDWHULDOVXVHGWKHUHLQ,WVKDOOEHWKH&RQWUDFWRU V UHVSRQVLELOLW\WRIXUQLVKWKH2ZQHUGRFXPHQWDU\HYLGHQFHVKRZLQJWKHPDWHULDOVXVHGDQG VDOHVDQGXVHWD[SDLGE\WKH&RQWUDFWRUDQGHDFKRILWVVXEFRQWUDFWRUV G6KRXOGWKH2ZQHUUHFHLYHQRWLFHWKDWWKH&RQWUDFWRUKDVIDLOHGWRSD\D6XEFRQWUDFWRUIRUWKH :RUNSHUIRUPHGUHODWHGWRD5HTXHVWIRU3D\PHQW2ZQHUVKDOOKDYHWKHDXWKRULW\WRZLWKKROG SD\PHQW RI WKH GLVSXWHG DPRXQW XQWLO SDUWLHV UHVROYH WKHLU GLVSXWH )DLOXUH WR SD\ WKH &RQWUDFWRUSXUVXDQWWRWKLVVHFWLRQRIWKH$JUHHPHQWVKDOOQRWEHGHHPHGWREHDEUHDFKRIWKH $JUHHPHQW 121±$335235,$7,21 D&RQWUDFWRU DFNQRZOHGJHV WKDW 2ZQHU LV D JRYHUQPHQWDO HQWLW\ DQG WKH YDOLGLW\ RI WKLV $JUHHPHQWLVEDVHGXSRQWKHDYDLODELOLW\RISXEOLFIXQGLQJXQGHUWKHDXWKRULW\RILWVVWDWXWRU\ PDQGDWH E,QWKHHYHQWWKDWSXEOLFIXQGVDUHXQDYDLODEOHDQGQRWDSSURSULDWHGIRUWKHSHUIRUPDQFHRI 2ZQHU¶VREOLJDWLRQVXQGHUWKLV$JUHHPHQWWKHQWKLV$JUHHPHQWVKDOODXWRPDWLFDOO\H[SLUH ZLWKRXWSHQDOW\WR2ZQHULPPHGLDWHO\XSRQZULWWHQQRWLFHWR&RQWUDFWRURIWKHXQDYDLODELOLW\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 5 DQGQRQDSSURSULDWLRQRISXEOLFIXQGV,WLVH[SUHVVO\DJUHHGWKDW2ZQHUVKDOOQRWDFWLYDWHWKLV QRQDSSURSULDWLRQ SURYLVLRQ IRU LWV FRQYHQLHQFH RU WR FLUFXPYHQW WKH UHTXLUHPHQWV RI WKLV $JUHHPHQWEXWRQO\DVDQHPHUJHQF\ILVFDOPHDVXUHGXULQJDVXEVWDQWLDOILVFDOFULVLV F,Q WKH HYHQW RI D FKDQJH LQ WKH 2ZQHU¶V VWDWXWRU\ DXWKRULW\ PDQGDWH DQGRU PDQGDWHG IXQFWLRQV E\ VWDWH DQGRU IHGHUDO OHJLVODWLYH RU UHJXODWRU\ DFWLRQ ZKLFK DGYHUVHO\ DIIHFWV 2ZQHU¶VDXWKRULW\WRFRQWLQXHLWVREOLJDWLRQVXQGHUWKLV$JUHHPHQWWKHQWKLV$JUHHPHQWVKDOO DXWRPDWLFDOO\WHUPLQDWHZLWKRXWSHQDOW\WR2ZQHUXSRQZULWWHQQRWLFHWR&RQWUDFWRURIVXFK OLPLWDWLRQRUFKDQJHLQ2ZQHU¶VOHJDODXWKRULW\ 127,&(6 $Q\QRWLFHUHTXLUHGE\WKLV$JUHHPHQWVKDOOEHLQZULWLQJDQGGHOLYHUHGE\FHUWLILHGRUUHJLVWHUHGPDLO UHWXUQUHFHLSWUHTXHVWHGWRWKHIROORZLQJ 2ZQHU &RQWUDFWRU 2UDQJH&RXQW\ $WWQ 32%R[ +LOOVERURXJK1& 0,6&(//$1(286 D'XWLHVDQG2EOLJDWLRQVLPSRVHGE\WKH&RQWUDFW'RFXPHQWVVKDOOEHLQDGGLWLRQWRDQ\'XWLHV DQG2EOLJDWLRQVLPSRVHGE\VWDWHIHGHUDORUORFDOODZUXOHVUHJXODWLRQVDQGRUGLQDQFHV E1RDFWRUIDLOXUHWRDFWE\WKH2ZQHURU&RQWUDFWRUVKDOOFRQVWLWXWHDZDLYHURIDQ\ULJKWRU GXW\JUDQWHGWKHPXQGHUWKH&RQWUDFW'RFXPHQWVQRUVKDOODQ\DFWRUIDLOXUHWRDFWFRQVWLWXWH DQ\DSSURYDOH[FHSWDVVSHFLILFDOO\DJUHHGLQZULWLQJ F7KH:RUNVKDOOEHWHVWHGDQGLQVSHFWHGDVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVDQGDVUHTXLUHG E\ODZ8QOHVVSURKLELWHGE\ODZWKHFRVWVRIDOOVXFKWHVWVDQGLQVSHFWLRQVUHODWHGWRVWDWHDQG IHGHUDOFRGHVVXFKDV$'$$GPLQLVWUDWLYH(OHFWULFDO3OXPELQJ0HFKDQLFDODQG%XLOGLQJ &RGHVVKDOOEHERUQHE\WKH&RQWUDFWRU7KHFRVWVIRUPDWHULDODQGVWUXFWXUDOWHVWLQJVKDOOEH FRQGXFWHGE\DQLQGHSHQGHQWWKLUGSDUW\DWWKHH[SHQVHRIWKH2ZQHU'HOD\VUHODWHGWRDQ\RI WKHDIRUHPHQWLRQHGWHVWVDQGLQVSHFWLRQVVKDOOQRWEHJURXQGVIRUGHOD\LQJWKHFRPSOHWLRQRI WKHZRUN,IDQ\VXFKWHVWVDQGLQVSHFWLRQVUHYHDOGHILFLHQFLHVLQWKH:RUNVXFKWKDWWKH:RUN GRHV QRW FRPSO\ ZLWK WHUPV RU UHTXLUHPHQWV RI WKH &RQWUDFW 'RFXPHQWV DQGRU WKH UHTXLUHPHQWVRIDQ\FRGHRUODZWKH&RQWUDFWRULVVROHO\UHVSRQVLEOHIRUWKHFRVWRIEULQJLQJ VXFKGHILFLHQFLHVLQWRFRPSOLDQFHZLWKWKHWHUPVRIWKH&RQWUDFW'RFXPHQWVDQGRUDQ\FRGH RUODZ G6KRXOGWKH'HVLJQHULID'HVLJQHULVUHWDLQHGIRUWKHSURMHFWLQYROYLQJWKH:RUNRU2ZQHU UHMHFWDQ\SRUWLRQRIWKH:RUNIRUIDLOLQJWRFRPSO\ZLWKWKH&RQWUDFW'RFXPHQWV&RQWUDFWRU VKDOOLPPHGLDWHO\DW&RQWUDFWRU¶VH[SHQVHFRUUHFWWKH:RUN$Q\VXFKUHMHFWLRQPD\EH PDGHEHIRUHRUDIWHUVXEVWDQWLDOFRPSOHWLRQ,IDSSOLFDEOHDQ\DGGLWLRQDOH[SHQVHERUQHE\WKH 'HVLJQHUXQGHUWKLVVHFWLRQVKDOOEHSDLGDW&RQWUDFWRU¶VH[SHQVH H7KH&RXQW\KDVGHVLJQDWHG WRDFWDVWKH&RXQW\ VUHSUHVHQWDWLYHZLWKUHVSHFWWRWKH 3URMHFWDQGVKDOOKDYHWKHDXWKRULW\WRUHQGHUGHFLVLRQVZLWKLQJXLGHOLQHVHVWDEOLVKHGE\WKH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 6 &RXQW\0DQDJHUDQGRUWKH&RXQW\%RDUGRI&RPPLVVLRQHUVDQGVKDOOEHDYDLODEOHGXULQJ ZRUNLQJ KRXUV DV RIWHQ DV PD\ EH UHDVRQDEO\ UHTXLUHG WR UHQGHUGHFLVLRQV DQG WR IXUQLVK LQIRUPDWLRQ I7KH&RQWUDFWRUVKDOOQRWDVVLJQDQ\SRUWLRQRIWKLV$JUHHPHQWQRUVXEFRQWUDFWWKH:RUNLQLWV HQWLUHW\ZLWKRXWWKHSULRUZULWWHQFRQVHQWRIWKH2ZQHU &216(48(17,$/'$0$*(6 D2ZQHUDQG&RQWUDFWRUPXWXDOO\ZDLYHDQ\FODLPDJDLQVWHDFKRWKHUIRUFRQVHTXHQWLDOGDPDJHV &RQVHTXHQWLDO'DPDJHVLQFOXGH L'DPDJHVLQFXUUHGE\2ZQHUIRUORVVRIXVHLQFRPHILQDQFLQJRUEXVLQHVV LL'DPDJHV LQFXUUHG E\ &RQWUDFWRU IRU RIILFH H[SHQVHV LQFOXGLQJ SHUVRQQHO ORVV RI ILQDQFLQJ SURILW LQFRPH EXVLQHVV GDPDJH WR UHSXWDWLRQ RU DQ\ RWKHU QRQGLUHFW GDPDJHV (17,5($*5((0(17 $OORIWKHGRFXPHQWVOLVWHGUHIHUHQFHGRUGHVFULEHGLQWKLV$JUHHPHQWWKHZULWWHQ1RWLFHWR3URFHHG WRJHWKHUZLWK0RGLILFDWLRQVPDGHRULVVXHGLQDFFRUGDQFHKHUHZLWKDUHWKH&RQWUDFW'RFXPHQWVDQGWKHZRUN ODERUPDWHULDOVDQGFRPSOHWHGFRQVWUXFWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVDQGDOOSDUWVWKHUHRILVWKH :RUN 7KH &RQWUDFW 'RFXPHQWV FRQVWLWXWH WKH HQWLUH DJUHHPHQW EHWZHHQ 2ZQHU DQG &RQWUDFWRU 7KLV $JUHHPHQW PD\ EH DPHQGHG RQO\ E\ ZULWWHQ LQVWUXPHQW VLJQHG E\ ERWK SDUWLHV 0RGLILFDWLRQV PD\ EH HYLGHQFHGE\IDFVLPLOHVLJQDWXUHV,IDQ\SURYLVLRQRIWKH$JUHHPHQWRU*HQHUDO&RQGLWLRQVVKDOOEHGHFODUHG LQYDOLGRUXQHQIRUFHDEOHWKHUHPDLQGHURIWKH$JUHHPHQWVKDOOFRQWLQXHLQIXOOIRUFHDQGHIIHFW >6,*1$785(3$*(72)2//2:@ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 7 ,1:,71(66:+(5(2)WKH3DUWLHVKHUHWRKDYHH[HFXWHGWKLV$JUHHPHQWDVRIWKHGD\DQGGDWH ILUVWDERYHZULWWHQLQDQXPEHURIFRXQWHUSDUWVHDFKRIZKLFKVKDOOZLWKRXWSURRIRUDFFRXQWLQJIRURWKHU FRXQWHUSDUWVEHGHHPHGDQRULJLQDOFRQWUDFW 25$1*(&2817< &2175$&725 %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Printed Name and Title DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 8 25$1*(&2817<²'(3$570(1786(21/< BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3DUW\9HQGRU1DPH 3DUW\9HQGRU&RQWDFW3HUVRQ &RQWDFW3KRQH3DUW\9HQGRU$GGUHVV&LW\ 6WDWH =LS 'HSDUWPHQW $PRXQW 3XUSRVH%XGJHW&RGHV9HQGRU 1$LIQHZYHQGRU9HQGRULVD%2&&FRQVXOWDQW"<HV1R &RQWUDFW7\SH&KHFNRQH1HZ5HQHZDO $PHQGPHQW(IIHFWLYH'DWH $SSURYHGE\%RDUG<HV 1R $JHQGD'DWH 7KLVDJUHHPHQWLVDSSURYHGDVWRWHFKQLFDOIRUPDQGFRQWHQWDQG,DV'HSDUWPHQW'LUHFWRUDIILUPDWLYHO\VWDWHZRUNRQWKLV SURMHFWKDVQRWEHHQLQLWLDWHGSULRUWRH[HFXWLRQRIWKHDJUHHPHQW 'HSDUWPHQW'LUHFWRU¶V6LJQDWXUHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBB $JUHHPHQWVIRUHPHUJHQF\VHUYLFHVRUUHSDLUDUHQRWVXEMHFWWRWKHDERYHDIILUPDWLRQ,IVHUYLFHVUHODWHGWRWKLVDJUHHPHQWKDYH DOUHDG\EHJXQRUEHHQFRPSOHWHGSOHDVHEULHIO\GHVFULEHWKHQDWXUHRIWKHHPHUJHQF\FRQGLWLRQWKDWZDVDGGUHVVHG 5LVN0DQDJHPHQW 7KLVDJUHHPHQWLVDSSURYHGIRUVXIILFLHQF\RILQVXUDQFHVWDQGDUGVVSHFLILFDWLRQVDQGUHTXLUHPHQWV 2IILFHRIWKH5LVN0DQDJHPHQW2IILFHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBB )LQDQFLDO6HUYLFHV 7KLVLQVWUXPHQWKDVEHHQSUHDXGLWHGLQWKHPDQQHUUHTXLUHGE\WKH/RFDO*RYHUQPHQW%XGJHWDQG)LVFDO&RQWURO$FW 2IILFHRIWKH&KLHI)LQDQFLDO2IILFHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBB /HJDO6HUYLFHV 7KLVDJUHHPHQWLVDSSURYHGDVWROHJDOIRUPDQGVXIILFLHQF\ 2IILFHRIWKH&RXQW\$WWRUQH\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBB &OHUNWRWKH%RDUG 5HFHLYHGIRUUHFRUGUHWHQWLRQ $OO'RFXVLJQFRQWUDFWVPXVWEHFRSLHGWR6KHUUL,QJHUVROOXSRQFRPSOHWLRQVLQJHUVROO#RUDQJHFRXQW\QFJRY 7KHIROORZLQJVLJQDWXUHEORFNLVIRUKDUGFRSLHVRQO\DQGLVQRWUHTXLUHGIRU'RFXVLJQFRQWUDFWV 2IILFHRIWKH&OHUNWRWKH%RDUGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB'DWHBBBBBBBBB DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 )2502)3(5)250$1&(%21' 'DWHRI&RQWUDFW 'DWHRI([HFXWLRQ 1DPHRI3ULQFLSDO &RQWUDFWRU 1DPHRI6XUHW\ 1DPHRI&RQWUDFWLQJ %RG\ $PRXQWRI%RQG 3URMHFW .12:$//0(1%<7+(6(35(6(176WKDWZHWKHSULQFLSDODQGVXUHW\DERYH QDPHG DUH KHOG DQG ILUPO\ ERXQG XQWR WKH DERYH QDPHG FRQWUDFWLQJ ERG\ KHUHLQDIWHU FDOOHGWKHFRQWUDFWLQJERG\LQWKHSHQDOVXPRIWKHDPRXQWVWDWHGDERYHIRUWKHSD\PHQW RI ZKLFK VXP ZHOO DQG WUXO\ WR EH PDGH ZH ELQG RXUVHOYHV RXU KHLUV H[HFXWRUV DGPLQLVWUDWRUVDQGVXFFHVVRUVMRLQWO\DQGVHYHUDOO\ILUPO\E\WKHVHSUHVHQWV 7+( &21',7,21 2) 7+,6 2%/,*$7,21 ,6 68&+ WKDW ZKHUHDV WKH SULQFLSDO HQWHUHGLQWRDFHUWDLQFRQWUDFWZLWKWKHFRQWUDFWLQJERG\LGHQWLILHGDVVKRZQDERYHDQG KHUHWRDWWDFKHG 12:7+(5()25(LIWKHSULQFLSDOVKDOOZHOODQGWUXO\SHUIRUPDQGIXOILOODOOWKH XQGHUWDNLQJV FRYHQDQWV WHUPV FRQGLWLRQV DQG DJUHHPHQWV RI VDLG FRQWUDFW GXULQJ WKH RULJLQDO WHUP RI VDLG FRQWUDFW DQG DQ\ H[WHQVLRQV WKHUHRI WKDWPD\ EH JUDQWHG E\ WKH FRQWUDFWLQJERG\ZLWKRUZLWKRXWQRWLFHWRWKHVXUHW\DQGGXULQJWKHOLIHRIDQ\JXDUDQW\ UHTXLUHG XQGHU WKH FRQWUDFW DQG VKDOO DOVR ZHOO DQG WUXO\ SHUIRUP DQG IXOILOO DOO WKH XQGHUWDNLQJVFRYHQDQWVWHUPVFRQGLWLRQVDQGDJUHHPHQWVRIDQ\DQGDOOGXO\DXWKRUL]HG PRGLILFDWLRQVRIVDLGFRQWUDFWWKDWPD\KHUHDIWHUEHPDGHQRWLFHRIZKLFKPRGLILFDWLRQVWR WKHVXUHW\EHLQJKHUHE\ZDLYHGWKHQWKLVREOLJDWLRQWREHYRLGRWKHUZLVHWRUHPDLQLQIXOO IRUFHDQGYLUWXH ,1 :,71(66 :+(5(2) WKH DERYHERXQGHQ SDUWLHV KDYH H[HFXWHG WKLV LQVWUXPHQWXQGHUWKHLUVHYHUDOVHDOVRQWKHGDWHLQGLFDWHGDERYHWKHQDPHDQGFRUSRUDWH VHDORIHDFKFRUSRUDWHSDUW\EHLQJKHUHWRDIIL[HGDQGWKHVHSUHVHQWVGXO\VLJQHGE\LWV XQGHUVLJQHGUHSUHVHQWDWLYHSXUVXDQWWRDXWKRULW\RILWVJRYHUQLQJERG\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ([HFXWHGLQFRXQWHUSDUWV :LWQHVV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RQWUDFWRU7UDGHRU&RUSRUDWH1DPH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3URSULHWRUVKLSRU3DUWQHUVKLS $WWHVW&RUSRUDWLRQ 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 2ZQHU3DUWQHURU&RUS3UHVRU9LFH 3UHVRQO\ %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RUS6HFRU$VVW6HFRQO\ &RUSRUDWH6HDO BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RPSDQ\ :LWQHVV %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB $WWRUQH\LQ)DFW &RXQWHUVLJQHG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RUSRUDWH6HDO BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1&/LFHQVHG5HVLGHQW$JHQW BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1DPHDQG$GGUHVV6XUHW\$JHQF\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RPSDQ\1DPHDQG1& 5HJLRQDORU%UDQFK2IILFH$GGUHVV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 )2502)3$<0(17%21' 'DWHRI&RQWUDFW 'DWHRI([HFXWLRQ 1DPHRI3ULQFLSDO &RQWUDFWRU 1DPHRI6XUHW\ 1DPHRI&RQWUDFWLQJ %RG\ $PRXQWRI%RQG 3URMHFW .12:$//0(1%<7+(6(35(6(176WKDWZHWKHSULQFLSDODQGVXUHW\DERYH QDPHG DUH KHOG DQG ILUPO\ ERXQG XQWR WKH DERYH QDPHG FRQWUDFWLQJ ERG\ KHUHLQDIWHU FDOOHGWKHFRQWUDFWLQJERG\LQWKHSHQDOVXPRIWKHDPRXQWVWDWHGDERYHIRUWKHSD\PHQW RI ZKLFK VXP ZHOO DQG WUXO\ WR EH PDGH ZH ELQG RXUVHOYHV RXUKHLUV H[HFXWRUV DGPLQLVWUDWRUVDQGVXFFHVVRUVMRLQWO\DQGVHYHUDOO\ILUPO\E\WKHVHSUHVHQWV 7+( &21',7,21 2) 7+,6 2%/,*$7,21 ,6 68&+ WKDW ZKHUHDV WKH SULQFLSDO HQWHUHGLQWRDFHUWDLQFRQWUDFWZLWKWKHFRQWUDFWLQJERG\LGHQWLILHGDVVKRZQDERYHDQG KHUHWRDWWDFKHG 12:7+(5()25(LIWKHSULQFLSDOVKDOOSURPSWO\PDNHSD\PHQWWRDOOSHUVRQV VXSSO\LQJODERUPDWHULDOLQWKHSURVHFXWLRQRIWKHZRUNSURYLGHGIRULQVDLGFRQWUDFWDQG DQ\ DQG DOO GXO\ DXWKRUL]HG PRGLILFDWLRQV RI VDLG FRQWUDFWWKDW PD\ KHUHDIWHU EH PDGH QRWLFHRIZKLFKPRGLILFDWLRQVWRWKHVXUHW\EHLQJKHUHE\ZDLYHGWKHQWKLVREOLJDWLRQWREH YRLGRWKHUZLVHWRUHPDLQLQIXOOIRUFHDQGYLUWXH ,1:,71(66:+(5(2)WKHDERYHERXQGHQSDUWLHVKDYHH[HFXWHGWKLVLQVWUXPHQW XQGHUWKHLUVHYHUDOVHDOVRQWKHGDWHLQGLFDWHGDERYHWKHQDPHDQGFRUSRUDWHVHDORIHDFK FRUSRUDWHSDUW\EHLQJKHUHWRDIIL[HGDQGWKHVHSUHVHQWVGXO\VLJQHGE\LWVXQGHUVLJQHG UHSUHVHQWDWLYHSXUVXDQWWRDXWKRULW\RILWVJRYHUQLQJERG\ ([HFXWHGLQFRXQWHUSDUWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 :LWQHVV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RQWUDFWRU7UDGHRU&RUSRUDWH1DPH BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB%\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 3URSULHWRUVKLSRU3DUWQHUVKLS $WWHVW&RUSRUDWLRQ 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 2ZQHU 3DUWQHU RU &RUS 3UHV RU 9LFH 3UHVRQO\ %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &RUS6HFRU$VVW6HFRQO\ &RUSRUDWH6HDO BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RPSDQ\ :LWQHVV %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7LWOHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB $WWRUQH\LQ)DFW &RXQWHUVLJQHG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RUSRUDWH6HDO BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1&/LFHQVHG5HVLGHQW$JHQW BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1DPHDQG$GGUHVV6XUHW\$JHQF\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 6XUHW\&RPSDQ\1DPHDQG1& 5HJLRQDORU%UDQFK2IILFH$GGUHVV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 6KHHWIRU$WWDFKLQJ3RZHURI$WWRUQH\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 6KHHWIRU$WWDFKLQJ,QVXUDQFH&HUWLILFDWHV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ADDENDUM NO. 02 – October 16, 2020 Sportsplex Main Building Roof Replacement Page 1 of 1 ADDENDUM #2 SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT ORANGE COUNTY, HILLSBOROUGH, NC BID No. 367-5288 ATLAS PROJECT NO. J2400 DATE: October 16, 2020 FROM: Rob Tatum, RRC – Atlas Engineering, Inc. To (via email): Angel Barnes – Orange County Asset Management Services Rob Tatum – Atlas Engineering Gary Kurth – AAR Roofing Will Trute – Allied Roofing Juan Rios – Curtis Construction Nathan Darrah – BAR Roofing and Maintenance Gary Daughtry – CFE, Inc. Chris Brackin – Muter Construction Matthew French – BIRS, Inc. Eddie Lester – B&M Roofing Caleb Smith – Hamlin Roofing Brady Knowles – Owens Roofing, Inc. Will Diachenko – Baker Roofing Jack Brewer – Brewer Scaffold Ryan Walsh – Sarnafil Jim Taylor – Carolina Construction and Restoration This addendum forms a part of the Contract Documents titled “Sportsplex Main Building Roof Replacement” dated August 2020. Acknowledge receipt of this Addendum in the space provided on the Form of Proposal. Failure to do so may subject the Bidder to disqualification. Please fill out at the attached Affidavit for the E-verify and Living Wage and submit it with your proposal. END OF ADDENDUM DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 STATE OF NORTH CAROLINA AFFIDAVIT ORANGE COUNTY ************************** I, ____________________________(the individual attesting below), being duly authorized by and on behalf of ________________________________ (the entity bidding on project hereinafter "Employer") after first being duly sworn hereby swears or affirms as follows: 1. Employer understands that E-Verify is the federal E-Verify program operated by the United States Department of Homeland Security and other federal agencies, or any successor or equivalent program used to verify the work authorization of newly hired employees pursuant to federal law in accordance with NCGS §64-25(5). 2. Employer understands that Employers Must Use E-Verify. Each employer, after hiring an employee to work in the United States, shall verify the work authorization of the employee through E-Verify in accordance with NCGS§64-26(a). 3. Employer is a person, business entity, or other organization that transacts business in this State and that employs 25 or more employees in this State. (mark Yes or No) a. YES _____, or b. NO _____ 4. Employer's subcontractors comply with E-Verify, and if Employer is the winning bidder on this project Employer will ensure compliance with E-Verify by any subcontractors subsequently hired by Employer. This ____ day of _______________, 201_. Signature of Affiant Print or Type Name: _________________________ State of North Carolina, _________ County Signed and sworn to (or affirmed) before me, this the _____ day of ________________, 20__. My Commission Expires: Notary Public (Affix Official/Notarial Seal) DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Section I: General Government and Administration Policy 10.0: Living Wage Contractor Policy Reviewed by: County Attorney/County Manager Approved by: County Manager Original Effective Date: July 1, 2017 Revisions: Policy Statement It is the policy of Orange County to ensure its employees, and all individuals who provide services for Orange County, are paid a living wage. Purpose To encourage all vendors and contractors to pay a living wage to all employees who perform work pursuant to a contract with Orange County. Applicability Applies to all Orange County contracts and purchases. Policy 10.1 Living Wage 10.1.1 Orange County is committed to providing its employees with a living wage and encourages all contractors and vendors doing business with Orange County to pursue the same goal. Orange County’s living wage is $14.95 per hour. To the extent possible, Orange County recommends that contractors and vendors seeking to do business with Orange County provide a living wage to their employees. 10.1.2 Prior to final execution of a contract with Orange County all contractors and vendors seeking to do business with Orange County shall submit to the County’s representative a statement indicating whether those employees who will perform work on the Orange County contract are paid at least the living wage amount set out above. If such employees do not make at least the living wage amount set out above the contractor or vendor shall indicate in the statement the actual amount paid to such employees. For bid projects this statement should be submitted as part of the bid packet. This policy may be reviewed annually and updated as needed by the Manager’s Office DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ADDENDUM NO. 03 – October 19, 2020 Sportsplex Main Building Roof Replacement Page 1 of 1 ADDENDUM #3 SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT ORANGE COUNTY, HILLSBOROUGH, NC BID No. 367-5288 ATLAS PROJECT NO. J2400 DATE: October 19, 2020 FROM: Rob Tatum, RRC – Atlas Engineering, Inc. To (via email): Angel Barnes – Orange County Asset Management Services Rob Tatum – Atlas Engineering Gary Kurth – AAR Roofing Will Trute – Allied Roofing Juan Rios – Curtis Construction Nathan Darrah – BAR Roofing and Maintenance Gary Daughtry – CFE, Inc. Chris Brackin – Muter Construction Matthew French – BIRS, Inc. Eddie Lester – B&M Roofing Caleb Smith – Hamlin Roofing Brady Knowles – Owens Roofing, Inc. Will Diachenko – Baker Roofing Jack Brewer – Brewer Scaffold Ryan Walsh – Sarnafil Jim Taylor – Carolina Construction and Restoration This addendum forms a part of the Contract Documents titled “Sportsplex Main Building Roof Replacement” dated August 2020. Acknowledge receipt of this Addendum in the space provided on the Form of Proposal. Failure to do so may subject the Bidder to disqualification. Please use the attached form of proposal. This revised Form of Proposal includes space to provide bid alternate pricing. The bid due date will remain by 3:00 p.m. on October 22, 2020. END OF ADDENDUM Attached: Form of Proposal DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Proposal Form –Sportsplex Main Building Roof Replacement 1 of 4 F O R M OF P R O P O S A L Sportsplex Main Building Roof Replacement Contract: Orange County, Hillsborough, NC Bidder: Date: The undersigned, as bidder, hereby declares that the only person or persons interested in this proposal as principal or principals is or are named herein and that no other person than herein mentioned has any interest in this proposal or in the contract to be entered into; that this proposal is made without connection with any other person, company or parties making a bid or proposal; and that it is in all respects fair and in good faith without collusion or fraud. The bidder further declares that he has examined the site of the work and the contract documents relative thereto and has read all special provisions furnished prior to the opening of bids; that he has satisfied himself relative to the work to be performed. The bidder further declares that he and his subcontractors have fully complied with NCGS 64, Article 2 in regards to E-Verification as required by Section 2.(c) of Session Law 2013-418, codified as N.C. Gen. Stat. § 143-129(j). . The Bidder proposes and agrees if this proposal is accepted to contract with the Orange County, a political subdivision of the State of North Carolina (Orange County) in the form of contract specified below, to furnish all necessary materials, equipment, machinery, tools, apparatus, means of transportation and labor necessary to complete the construction of Sportsplex Main Building Roof Replacement in full in complete accordance with the plans, specifications and contract documents, to the full and entire satisfaction of Orange County and Atlas Engineering, Inc. with a definite understanding that no money will be allowed for extra work except as set forth in the General Conditions and the contract documents, for the sum of: SINGLE PRIME CONTRACT: Base Bid: Dollars($) General Subcontractor: Plumbing Subcontractor: Lic Lic Mechanical Subcontractor: Electrical Subcontractor: Lic Lic GS143-128(d) requires all single prime bidders to identify their subcontractors for the above subdivisions of work. A contractor whose bid is accepted shall not substitute any person as subcontractor in the place of the subcontractor listed in the original bid, except (i) if the listed subcontractor's bid is later determined by the contractor to be non-responsible or non-responsive or the listed subcontractor refuses to enter into a contract for the complete performance of the bid work, or (ii) with the approval of the awarding authority for good cause shown by the contractor. Revised per Addendum #3 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Proposal Form –Sportsplex Main Building Roof Replacement 2 of 4 ALTERNATES: Should any of the alternates as described in the contract documents be accepted, the amount written below shall be the amount to be “added to” or “deducted from” the base bid. (Strike out “Add” or “Deduct” as appropriate.) GENERAL CONTRACT: Bid Alternate 01: Prepare, prime, and paint equipment support at the locations shown on the drawings. (Add)(Deduct) Dollars($)_________________ Bid Alternate 02: Replace the pipe insulation at the location(s) shown on the drawings. (Add)(Deduct) Dollars($)_________________ Bid Alternate 03: Prepare, prime, and paint the natural gas lines on Roof Area A. (Add)(Deduct) Dollars($)_________________ UNIT PRICES Estimated quantities for each item below as defined in Section 012100, Paragraph 1.03.A of the Project Manual, shall be considered to have already been included within the base bid amount proposed above. The unit prices provided below shall be applied as appropriate, to compute the total value of changes in the scope of the work in the event that the quantity of actual work performed is more than or less than the estimated quantity. Unit prices quoted and accepted shall apply throughout the life of the contract, except as otherwise specifically noted. Unit prices shall be applied, as appropriate, to compute the total value of changes in the base bid quantity of the work all in accordance with the contract documents. GENERAL CONTRACT: No. 1 Metal Deck Restoration (sq.ft.) Unit Price ($) No. 2 Metal Deck Replacement (sq.ft.) Unit Price ($) No. 3 Metal Deck Repair (sq. ft.) Unit Price ($) No. 4 Wood Blocking Replacement (bd.ft.) Unit Price ($) No. 5 Plywood Replacement (sq.ft.) Unit Price ($)_____________ No. 6 5/8” Gypsum Board replacement (sq.ft.) Unit Price ($)_____________ No. 7 Additional Walk Tread Installation (ln. ft.) Unit Price ($) ____________ No. 8 Rubber Paver (ea.) Unit Price ($) ____________ No. 9 Tapered Insulation (bd. ft.) Unit Price ($) ____________ The bidder further proposes and agrees hereby to commence work under this contract on a date to be specified in a written order of the designer and shall fully complete all work thereunder within the time specified in the Supplementary General Conditions Article 23. Applicable liquidated damages amount is also stated in the Supplementary General Conditions Article 23. MINORITY BUSINESS PARTICIPATION REQUIREMENTS Provide with the bid - Under GS 143-128.2(c) the undersigned bidder shall identify on its bid (Identification of Minority Business Participation Form) the minority businesses that it will use on the project with the total dollar value of the bids that will be performed by the minority businesses. Also list the good faith efforts (Affidavit A) made to solicit minority participation in the bid effort. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Proposal Form –Sportsplex Main Building Roof Replacement 3 of 4 NOTE: A contractor that performs all of the work with its own workforce may submit an Affidavit (B) to that effect in lieu of Affidavit (A) required above. The MB Participation Form must still be submitted even if there is zero participation. After the bid opening - The Owner will consider all bids and alternates and determine the lowest responsible, responsive bidder. Upon notification of being the apparent low bidder, the bidder shall then file within 72 hours of the notification of being the apparent lowest bidder, the following: An Affidavit (C) that includes a description of the portion of work to be executed by minority businesses, expressed as a percentage of the total contract price, which is equal to or more than the 10% goal established. This affidavit shall give rise to the presumption that the bidder has made the required good faith effort and Affidavit D is not necessary; * OR * If less than the 10% goal, Affidavit (D) of its good faith effort to meet the goal shall be provided. The document must include evidence of all good faith efforts that were implemented, including any advertisements, solicitations and other specific actions demonstrating recruitment and selection of minority businesses for participation in the contract. Note: Bidders must always submit with their bid the Identification of Minority Business Participation Form listing all MB contractors, vendors and suppliers that will be used. If there is no MB participation, then enter none or zero on the form. Affidavit A or Affidavit B, as applicable, also must be submitted with the bid. Failure to file a required affidavit or documentation with the bid or after being notified apparent low bidder is grounds for rejection of the bid. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Proposal Form –Sportsplex Main Building Roof Replacement 4 of 4 Proposal Signature Page The undersigned further agrees that in the case of failure on his part to execute the said contract and the bonds within ten (10) consecutive calendar days after being given written notice of the award of contract, the certified check, cash or bid bond accompanying this bid shall be paid into the funds of the owner's account set aside for the project, as liquidated damages for such failure; otherwise the certified check, cash or bid bond accompanying this proposal shall be returned to the undersigned. Respectfully submitted this day of (Name of firm or corporation making bid) WITNESS: By: Signature Name: (Proprietorship or Partnership) Print or type Title______________ (Owner/Partner/Pres./V.Pres) Address ATTEST: By: License No. Title: Federal I.D. No. (Corp. Sec. or Asst. Sec. only) Email Address: (CORPORATE SEAL) Addendum received and used in computing bid: Addendum No. 1 Addendum No. 3 Addendum No. 5 Addendum No. 7 Addendum No. 2 Addendum No. 4 Addendum No. 6 Addendum No. 8 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 N.I.C. N.I.C. ROOF AREA A ROOF AREA B 1 1 1 1 1 1 2 33 3 1 1 ROOF AREA B 11'-3" 28'-3"35'-7" 61' 51' 31'-8" 14' 4' 25'-6" 40'-4" 119'-3" 53'-5" 30' 36'-9" 40'-2" 38'-2" 5'-4" 4'-6" 105'-5" RL RL RL RL V V V V V V V V V V V 5 5 5 5 4 4 6 6 6 1 7 13 13 10 10 8 12 12 12 9 V 24'-5" 54'-9" 123' 48'-10" 32'-8" 115'-7" 2.0 3 2.0 4 2.0 2 3.0 12 2.0 2 11 2.0 4 2.0 5 2.0 5 3.0 10 2.0 5 3.0 13 TYP. 2.0 5 3.0 11 TYP. 3.0 19 2.0 1 3.0 17 3.0 14 2.0 6 3.0 7 3.0 7 3.0 9 SIM. TYP. 2.0 1 3.0 10 TYP. 2.0 5 SIM. 3.0 19 3.0 8 3.0 18 3.0 17 2.0 1 2.0 5 2.0 1 4.0 22 4.0 21 4.0 21 4.0 21 3.0 15 4.0 21 2.0 2 2.0 2 N.I.C. 9 PARAPET WALL IN-WALL EXPANSION JOINT GRAVEL-STOP EDGE SCUPPER DRAIN MECHANICAL EQUIPMENT CURB RAIL CURB ROUND PENETRATION LEGEND # ## SATELLITE DETAIL CUT NOTE WALKPAD SLOPE DIRECTION RIDGE VALLEY STRUCTURAL RIDGE STRUCTURAL VALLEY RL V 1 REMOVE ABANDONED CURB/PENETRATION 2 RE-PIPE OVERFLOW DRAIN 3 INSTALL NEW 8"X16" OVERFLOW SCUPPER 4 WIDEN EXISTING SCUPPER TO 16" WIDE 5 REPLACE OVERFLOW CLAMPING RING WITH 6" 6 RAISE GAS PIPE TRAP 7 RAISE WATER/GAS PIPE 8 INSTALL ROOF HATCH RAIL 9 PAINT UNDERSIDE OF THE DECK OF ROOF AREA B 10 INSTALL NEW FALL PROTECTION ANCHOR 11 INSTALL NON-PENETRATING HANDRAIL 12 PAINT EQUIPMENT SUPPORT (ALTERNATE BID 1) 13 REPLACE PIPE INSULATION (ALTERNATE BID 2) NOTES KEYED TO DETAIL CUT PLAN: 1.THESE DRAWINGS ACCOMPANY A PROJECT MANUAL BY ATLAS ENGINEERING DATED AUGUST 2020. THE DRAWINGS ARE PROVIDED TO COMMUNICATE EXISTING CONDITIONS, DESIGN INTENT, AND GENERAL REFERENCE. CONTRACTOR SHALL FIELD VERIFY DIMENSIONS, DRAWING SCALES, ROOF CONSTRUCTIONS, AND ALL OTHER CONDITIONS THAT WILL AFFECT THE ROOF REPLACEMENT AND STAGING AND STORAGE SHOWN ON THIS PLAN AND THE COVER SHEET FOR THE PURPOSE OF BIDDING AND CONSTRUCTION. SOME FEATURES SUCH AS PENETRATIONS MAY NOT BE SHOWN TO EXACT SCALE FOR PURPOSE OF CLARITY. 2.THE EXISTING ROOF SYSTEM CONSTRUCTIONS WERE OBSERVED AT SELECTED, REPRESENTATIVE AREAS AND ARE LISTED IN THE SPECIFICATIONS. 3.COORDINATE STORAGE AND STAGING AREAS WITH THE OWNER. PROTECT EXISTING BUILDING, EQUIPMENT, SITE FEATURES, AND STORAGE AND STAGING AREAS FROM DAMAGE DUE TO CONSTRUCTION ACTIVITIES. IF DAMAGE OCCURS, REPAIR AREAS TO RETURN THEM TO THEIR CONDITION PRIOR TO THE START OF CONSTRUCTION. 4.FOLLOW ALL OSHA AND ORANGE COUNTY SAFETY REGULATIONS. 5.VERIFY WALK TREAD LOCATIONS WITH THE DESIGNER. 6.PROVIDE A 6' CHAIN LINK FENCE WITH NON-PENETRATING WEIGHTED BASES AT THE MATERIAL STORAGE AREA SHOWN ON THE COVER SHEET UNLESS OTHERWISE APPROVED BY THE OWNER. 7.INSTALL TAPERED INSULATION BEHIND ALL CURBS WIDER THAN 2'. 8.ENTRANCES/EXITS MUST BE PROTECTED THROUGH THE USE OF OVERHEAD PROTECTION. A SPOTTER MAY BE REQUIRED ON THE GROUND WHEN WORK ABOVE IS OCCURRING DURING HOURS WHEN THE BUILDING IS OCCUPIED. DO NOT BLOCK PEDESTRIAN OR VEHICULAR ACCESS TO THE BUILDING. GENERAL NOTES: No.REVISION By Date DRAWN BY: ENGINEER: APPROVAL: DATE: PROJ.:SCALE: DWG. NO. 1.0 RT KEW AS SHOWNJ2400ROOF PLAN1 1.0 SCALE: 3/32" = 1'-0" ROOF PLAN KEW BID DOCUMENTS 08/04/2020ORANGE COUNTY SPORTSPLEX MAIN BUILDING ROOF REPLACEMENTHILLSBOROUGH, NORTH CAROLINAORANGE COUNTY ASSET MANAGEMENT SERVICESDocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 N.I.C.N.I.C.PERIMETER CORNER FIELD12'12'6'6'N.I.C.1.COMPONENTS SHOWN ON THE DETAILS SHALL BE CONSIDERED TO BE NEW UNLESS NOTED ASEXISTING.2.CRIMP COPING AND EDGE METAL TO CLEATS A MINIMUM OF 12" O.C.3.NAILERS/WOOD BLOCKING ARE TO BE FASTENED AT 12" O.C. STAGGERED WITH 2 FASTENERS AT EACHEND.4.ANY NEW PLYWOOD ON THE WALLS IS TO BE SECURED EVERY 2 SF.5.USE A MINIMUM OF 8" BACKUP PLATES AT THE COPING JOINTS. INSTALL TWO BEADS OF SEALANT ONEACH SIDE OF THE BACKUP PLATE PRIOR TO INSTALLING THE COPING PLATE.6.TURN THE FIELD SHEET UP 2" AND SECURE TO THE WALL OR SECURE THROUGH THE MEMBRANE TO THEDECK. IF A TERMINATION BAR USED TO TERMINATE THE FIELD SHEET PERIMETER SHALL BE LOCATED AMINIMUM OF 1/4" AND A MAXIMUM OF 1/2" OFF THE MEMBRANE. MINIMUM 1" EMBEDMENT INTOSUBSTRATE.7.FASTENERS SHALL PENETRATE THE SUBSTRATE A MINIMUM OF 1" UNLESS OTHERWISE NOTED.8.DO NOT INSTALL TERMINATION BAR OR COPING ACROSS PRE-CAST AND BUILDING EXPANSION JOINTS.9.ALLOW 1/4" SPACING BETWEEN CONSECUTIVE LENGTHS OF TERMINATION BAR.10.DO NOT WRAP TERMINATION BAR AROUND CORNERS.11.COUNTERFLASHING IS TO EXTEND A MINIMUM OF 3" PAST THE TERMINATION BAR.12.BUTYL TAPE OR SEALANT IS TO BE INSTALLED BETWEEN EQUIPMENT, SUPPORTS ETC. AND THEFLASHING. INSTALL SEALANT AROUND THE TOP AND SIDES OF THE EQUIPMENT/SUPPORTS/ETC.13.ALL HOT AIR WELDS ARE TO BE A MINIMUM OF 1.5"14.EXTEND FLASHING A MINIMUM OF 4" ONTO THE FIELD.15.IF CONDITIONS ARE DISCOVERED THAT PREVENT THE PROPER INSTALLATION OF A DESIGN DETAIL ASSHOWN IN THE DRAWINGS, CONTRACTOR SHALL IMMEDIATELY NOTIFY THE ENGINEER TO ALLOW FORAPPROVAL OF SUGGESTED MODIFICATION.16.DUE TO SITE SPECIFIC CONDITIONS, SOME DETAILS MAY HAVE LIMITED OR RESTRICTED VERTICALFLASHING HEIGHTS, OR OTHER NON-STANDARD CONDITIONS. IT IS THE CONTRACTOR'SRESPONSIBILITY TO OBTAIN REQUIRED MANUFACTURER APPROVALS, INSPECTIONS, AND WRITTENACCEPTANCE OF VARIANCES AS NECESSARY TO PROVIDE THE SPECIFIED ROOF SYSTEM WARRANTY.17.NAILERS ALONG EXPANSION JOINTS ARE TO BE REMOVED AND NEW NAILERS INSTALLED. IF EXISTINGNAILERS ARE IN GOOD CONDITION, DISCUSS WITH THE OWNER'S REPRESENTATIVE PRIOR TO REUSE.THE CONTRACTOR WILL BE RESPONSIBLE TO VERIFY EXISTING SECUREMENT MEETS THESPECIFICATION AND FM REQUIREMENT FOR ANY EXISTING NAILERS TO REMAIN .CONSTRUCTION DETAIL NOTES:3" MIN.SEALANTPOLYMER COATED METALCLEAT TOP FASTENEDWITH RING SHANK NAILSAT 3" O.C. ON FLANGE ANDFACE FASTENED AT 12"O.C.PRE-FINISHEDMETAL COVEROVER CLEATHOT AIR WELDSEALANT1-1/2"MEMBRANE FLASHINGTO STRIP-IN COATEDMETALFINISH AT EXISTINGLOCATION1"EXISTINGNAILER - VERIFYSECUREMENT2"4"112"THERMOPLASTICMEMBRANEPLATE AND FASTENERHOT AIR WELDEXISTING BLOCK WALLVARIESEXISTING METALDECKCOVERBOARDMEMBRANE FLASHING, FULLY ADHERED-EXTEND OVER PARAPET WALL -SUPPLEMENTAL SECUREMENT WILL BEREQUIRED FOR PARAPET HEIGHTSGREATER THAN 40"BASE LAYERINSULATIONTOP LAYERINSULATIONNOTE:1.ADDITIONAL SECUREMENT WILL BE REQUIRED FOR PARAPET WALLS HIGHER THAN 40"2.IF PLYWOOD IS NOT REQUIRED ON THE WALLS BY THE MANUFACTURER, AN APPLICATIONOF FLASHING ADHESIVE IS TO BE APPLIED TO THE WALL AND ALLOWED TO DRY PRIOR TOINSTALLING THE FLASHING. A CREDIT WILL BE PROVIDED TO THE OWNER.INTERMITTENTSECUREMENTPLYWOOD FASTENED EVERY2 SFEXISTING NAILEREXISTING MASONRYEXISTING CAVITYINSULATIONEXISTING THERMALBARRIERCONTINUOUSCLEAT FASTEN AT12" O.C.EXISTING PRE-CASTWALL2"MINIMUMSLOPE1/4" PER FOOT TERMINATION BAR FASTENED AT 8" O.C.TAPERED EDGE STRIP FASTENEDEVERY 18" O.C.FIELDVERIFY3"4"112"FASTENER WITH EPDMWASHER AT 12" O.C.FINISH ATEXISTINGLOCATIONPRE-FINISHED METAL COPING -INSTALL 8" BACKUP PLATE AT JOINTSMEMBRANE FLASHING FULLY ADHERED,EXTEND OVER PARAPET WALLTHERMOPLASTICMEMBRANEHOT AIR WELDEXISTING METALDECKCOVERBOARDBASE LAYERINSULATIONTOP LAYERINSULATIONNOTE:1.IF PLYWOOD IS NOT REQUIRED ON THE WALLS BY THE MANUFACTURER, AN APPLICATIONOF FLASHING ADHESIVE IS TO BE APPLIED TO THE WALL AND ALLOWED TO DRY PRIOR TOINSTALLING THE FLASHING. A CREDIT WILL BE PROVIDED TO THE OWNER.PLYWOOD FASTENED EVERY2 SFEXISTING THERMALBARRIERPAINT EXPOSEDCOATED METAL TOMATCH EXISTINGEXTERIOR COLOR.4" WIDEPRE-FINISHED METALFACE PLATEMEMBRANE FLASHINGHOT AIR WELD1"TERMINATION BARFASTENED AT 8" O.C.MEMBRANE FLASHING FULLYADHERED, EXTEND OVERPARAPET WALLSEALANTCOATED METAL SCUPPERFLASHING 8" X 16". METALSEAM SHALL BE ALONG THETOP OF THE SCUPPER.HOT AIR WELDSLOPE1/4" PER FOOT2" MAX.1" MIN.112"4"CONTINUOUSCLEAT FASTEN AT12" O.C.THERMOPLASTICMEMBRANEMINIMUMSLOPE1/4" PER FOOT TAPERED EDGE STRIP FASTENEDEVERY 18" O.C.FIELDVERIFY3"FASTENER WITH EPDMWASHER AT 12" O.C.FINISH ATEXISTINGLOCATIONPRE-FINISHED METAL COPING -INSTALL 8" BACKUP PLATE AT JOINTSNOTE:1.IF PLYWOOD IS NOT REQUIRED ON THE WALLS BY THE MANUFACTURER, AN APPLICATIONOF FLASHING ADHESIVE IS TO BE APPLIED TO THE WALL AND ALLOWED TO DRY PRIOR TOINSTALLING THE FLASHING. A CREDIT WILL BE PROVIDED TO THE OWNER.EXISTING METALDECKCOVERBOARDBASE LAYERINSULATIONTOP LAYERINSULATIONPLYWOOD FASTENED EVERY 2 SFEXISTING THERMALBARRIERTHERMOPLASTICMEMBRANE -EXTEND PASTFASTENER ANDFORM SLEEVE FORINSULATION.TERMINATION BARFASTENED AT 8" O.C.MEMBRANE FLASHING FULLYADHEREDTERMINATION BARFASTENED AT 8" O.C.SEALANT3"FIELDVERIFYSEALANTFASTENER WITH EPDMWASHER AT 12" O.C.SURFACE MOUNTEDCOUNTERFLASHING112"4"2"EXISTING METALDECKCOVERBOARDBASE LAYERINSULATIONTOP LAYERINSULATIONEXISTING THERMALBARRIERFOAM RODINSULATIONPLATE AND FASTENERHOT AIRWELDHOT AIR WELDMEMBRANE STRIPPINGEXISTINGMETALDECKTHERMOPLASTICMEMBRANECOVERBOARDTOP LAYERINSULATIONNOTE:1.REMOVE THE EXISTING WOOD BLOCKING AND INSTALL WOOD BLOCKING ON THE METALDECK.2.AFTER THE ROOF IS INSTALLED, THE UNDERSIDE OF THE METAL DECK SHALL BE PAINTEDWHITE.2"X6" WOOD NAILER FASTENEDAT 12" O.C. STAGGERED AND 2FASTENERS AT EACH ENDCOATED EDGE METALFASTENED AT 3" O.C.STAGGEREDCONTINUOUS CLEATFASTENED AT 8" O.C.6"MEMBRANE FLASHINGHOT AIR WELD1"MEMBRANE FLASHING FULLYADHERED, EXTEND OVERPARAPET WALLBUTYL TAPECOATED METAL SCUPPERFLASHING 8" X 16". METALSEAM SHALL BE ALONG THETOP OF THE SCUPPER.HOT AIR WELDCONTINUOUSCLEAT FASTEN AT12" O.C.THERMOPLASTICMEMBRANEMINIMUMSLOPE1/4" PER FOOT TAPERED EDGE STRIP FASTENEDEVERY 18" O.C.FIELDVERIFY3"FASTENER WITH EPDMWASHER AT 12" O.C.PRE-FINISHED METAL COPING -INSTALL 8" BACKUP PLATE AT JOINTSNOTE:1.IF PLYWOOD IS NOT REQUIRED ON THE WALLS BY THE MANUFACTURER, AN APPLICATIONOF FLASHING ADHESIVE IS TO BE APPLIED TO THE WALL AND ALLOWED TO DRY PRIOR TOINSTALLING THE FLASHING. A CREDIT WILL BE PROVIDED TO THE OWNER.EXISTING METALDECKCOVERBOARDBASE LAYERINSULATIONTOP LAYERINSULATIONPLYWOOD FASTENED EVERY 2 SFEXISTING THERMALBARRIERSEALANTFASTENER WITHEPDM WASHERCONDUCTOR HEADAND DOWNSPOUTTO MATCHEXISTING SIZE,COLOR, AND SHAPEFINISH ATEXISTINGLOCATIONNAILERS TO MATCH THEINSULATION THICKNESSNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.2.0RTKEWAS SHOWNCONSTRUCTION DETAILS 08/04/2020J2400KEWBID DOCUMENTSWIND UPLIFT PLANSCALE: 116"=1'1SCALE: 3" = 1'-0"PARAPET WALL2.02SCALE: 3" = 1'-0"PARAPET WALL (CONCRETE WALL)2.04SCALE: 3" = 1'-0"OVERFLOW SCUPPER (CONCRETE WALL)2.05SCALE: 3" = 1'-0"ROOF TO WALL2.06SCALE: 3" = 1'-0"EDGE (CANOPY)2.03SCALE: 3" = 1'-0"PRIMARY SCUPPER2.0ORANGE COUNTY SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICES DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 NOTES:1.CUT MEMBRANE TO EXTEND A MINIMUM OF 1" FROM THE ATTACHMENT POINTS OF THE DRAIN CLAMPING RING.2.HOLE IN MEMBRANE MUST EXCEED SIZE OF DRAIN PIPE BY 1".3.REPLACE ANY PLASTIC STRAINER WITH CAST IRON STRAINER.4.LOCATE LAPS AT LEAST 12" OUTSIDE DRAIN SUMP.5.INSTALL EXTENSION TO MODIFY/RAISE DRAINS AS NEEDED TO ALLOW FOR PROPER INSTALLATION OF NEW DRAIN SUMP.6.DO NOT SHAVE INSULATION.EXISTING DRAIN BOWLEXISTING DECK CLAMPTAPERED INSULATION (SUMP TO DRAIN)EXISTING CLAMPING RING -PAINT TO MATCH MANUFACTURER'S COLORMETAL DRAIN STRAINERPAINT TO MATCH MANUFACTURER'S COLORTHERMOPLASTICMEMBRANESEALANTINSULATION121/2FILL VOIDWITH FOAMINSULATION FASTENERAND PLATE AT 12" O.C.DRAIN FLASHINGHOT AIR WELD 2" MIN.EXISTING METAL DECK48"COVERBOARDEXISTING THERMALBARRIERPLATE AND FASTENERINSTALL SEALANT BETWEEN PIPEAND PREFABRICATED MEMBRANE FLASHINGTHERMOPLASTIC MEMBRANEHOT AIR WELDDECK FLANGES OF THE MOLDED PIPE BOOT SHALL NOT BE OVERLAPPED, CUT OR APPLIED OVER ANY ANGLE CHANGE.USE PIPE BOOT WHENEVER POSSIBLE.:NOTESSTAINLESS STEELCLAMPING RING2.1.8" MIN.PIPE, 1/2" TO 6-1/2"PRE-MOLDED PIPE BOOTSEALANT112"EXISTING THERMAL BARRIEREXISTING METALDECKCOVERBOARDTOP LAYERINSULATIONBASE LAYERINSULATIONSTAINLESS STEEL CLAMPSEALANTEXISTING ROUNDSEALANTPENETRATIONTHERMOPLASTIC MEMBRANE FLASHING HOT AIR WELD8" MIN.PLATE AND FASTENER112"MEMBRANENOTE:USE ONLY IF A PIPE BOOT CANNOT BE INSTALLED. INCLUDE SEPARATION TAPE ON PIPE IF CONTAMINANTS ARE PRESENTBASE LAYERINSULATIONEXISTING THERMALBARRIEREXISTING METALDECKCOVERBOARDTOP LAYER INSULATIONTHERMOPLASTICMEMBRANEHOT AIR WELD1-1/2"EXISTING HEATED STACK OR PIPESEALANTSTAINLESS STEEL CLAMPSTAINLESS STEEL CAPSEALANTMEMBRANE FLASHING,FULLY ADHEREDEXISTING SLEEVEPOP RIVETCOVERBOARDBASE LAYERINSULATIONSEALANTCLAMPING RINGTOP LAYERINSULATIONEXISTINGMETAL DECKEXISTINGTHERMAL BARRIERPIPE INSULATIONRAIN SHIELD8" MIN.HOT AIR WELDMEMBRANE FLASHING THERMOPLASTICPENETRATIONEXISTING ROUNDSTAINLESS STEEL CLAMPMEMBRANENOTE:1. REMOVE EXISTING PIPE INSULATION TO COMPLETE FLASHING.2. INSTALL NEW PIPE INSULATION AND TIE INTO EXISTING PIPE INSULATION.112"PLATE ANDFASTENERSEALANTEXISTING METAL DECKBASE LAYERINSULATIONEXISTING THERMAL BARRIERCOVERBOARDTOP LAYERINSULATIONSEALANT BENEATHSTAINLESS STEEL CLAMPRAIN SHIELDMEMBRANE FLASHING, ADHEREDPREMOLDED CORNERHOT AIR WELD8"SEALANTSTAINLESS STEEL CLAMPEXISTING STEELSQUARE TUBENOTE:1. TERMINATE FIELD SHEET IN ACCORDANCE WITH MANUFACTURER'S REQUIREMENTS.THERMOPLASTIC FLASHINGLIQUID APPLIEDFLASHING BASE COAT -20 MILSLIQUID APPLIED FLASHINGBASE COAT - 16 MILSLIQUID APPLIED FLASHING BASECOAT - 16 MILSPOLYFLEECE REINFORCEMENT,VERTICAL WRAP WITH 1" FINGERS TOSUBSTRATE - EMBED INTO BASE COATWITHOUT WRINKLES OR FOLDS.POLYFLEECE REINFORCEMENT TURNING UPVERTICAL 1/2" EMBED INTO BASE COATWITHOUT WRINKLES OR FOLDS.LIQUID APPLIED FLASHING FINISHCOAT - 20 MILS -TOP SURFACING OFEMBEDDED MATCHING GRANULESEXISTING SUBSTRATEEXISTING PENETRATION - PREPARESUBSTRATED AS REQUIRED BY THEMANUFACTURER.COATED METAL FLASHINGFASTENED AT 8" O.C. EXTENDOVER COUNTERFLASHING ATBASEPRE-FINISHED METALCOUNTERFLASHINGSEALANTCOPINGMEMBRANE FLASHINGTHERMOPLASTICMEMBRANE2"4"1"SEALANTSEALANT1"EXISTING DECK CLAMPPOURABLE SEALANT SLOPED TO SHED WATERPRE-FABRICATED CURBSEALANTEXISTING PENETRATION1"THERMOPLASTIC MEMBRANEINSTALL RAIN SHIELD (NOT SHOWN) ON PIPES, UNLESS OTHERWISE AGREEDUPON BY DESIGNER ON A CASE BY CASE BASIS2"FOR SEALANT POCKETNOTE:1.TO BE USED ON PENETRATIONS LESS THAN 2" ONLY UNLESS OTHERWISENOTED OR AGREED UPON BY DESIGNER.2.BUTYL SEALANTMEMBRANEFLASHINGEXISTING LADDER SUPPORTSEALANT AROUND EDGES - DO NOTINSTALL SEALANT AT BOTTOM OFPLATEFASTENEREXISTING WALL2"EXISTINGSTRUCTUREEXISTING TPOMEMBRANECLEATFASTENED AT8" O.C.SEALANTMEMBRANE STRIPPINGCOATED METAL FASTENEDAT 8" O.C.MEMBRANE STRIPPINGCOATED METAL FASTENEDAT 8" O.C. - EXTENDOVER TOP OFCOUNTERFLASHINGSEALANTBUTYL TAPEEXISTING ROOFSYSTEMEXISTING TPO MEMBRANE - PEELOUTSIDE EDGE UP SO NEWMEMBRANE FLASHING CAN BEINSTALLED UNDERNEATHEXISTINGSTRUCTUREEXISTING PLYWOODMEMBRANE FLASHING -INTERMEDIATEFASTENING MAY BEREQUIREDCONTINUOUS CLEATFASTENED AT 8" O.C.TPO COATED METALFASTENED AT 3" O.C..TPO STRIPPINGNOTE:1.PREPARE EXISTING TPO MEMBRANE IN ACCORDANCE WITH THE MANUFACTURER'SREQUIREMENTS TO RECEIVE NEW HEAT WELDED MEMBRANE.EXISTINGNAILERSHOT AIR WELDEXISTING CLEAT - VERIFYSECUREMENTEDGE METAL - CRIMP OVER TOPEXISTINGMETALDECKPLATE AND FASTENER AT 12" O.C.THERMOPLASTICMEMBRANECOVERBOARDTOP LAYERINSULATION1"FLASHING - EXTEND OVER EXISTING METALEXISTING EDGEMETAL CLEATNOTE:1.AFTER THE ROOF IS INSTALLED, THE UNDERSIDE OF THE METAL DECK SHALL BE PAINTEDWHITE.No.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.3.0RTKEWAS SHOWNCONSTRUCTION DETAILS 08/04/2020J2400KEWBID DOCUMENTS9SCALE: 1-1/2" = 1'-0"DRAIN3.010SCALE: 3" = 1'-0"PENETRATION (BOOT)3.011SCALE: 3" = 1'-0"PENETRATION (FIELD FLASHED)3.012SCALE: 3" = 1'-0"HOT PIPE3.013SCALE: 3" = 1'-0"INSULATED PIPE3.014SCALE: 3" = 1'-0"SQUARE PENETRATION3.015SCALE: 3" = 1'-0"LIQUID APPLIED FLASHING3.019SCALE: 3" = 1'-0"PARAPET TERMINATION3.016SCALE: 3" = 1'-0"PENETRATION POCKET3.017SCALE: 3" = 1'-0"PARAPET TERMINATION3.018SCALE: 3" = 1'-0"LADDER SUPPORT3.08SCALE: 3" = 1'-0"DRIP EDGE (CANOPY)3.07SCALE: 3" = 1'-0"EDGE METAL3.0ORANGE COUNTY SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICES DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 NOTE:1.EXACT BASE PLATE CONNECTION VARIES DEPENDING ON TYPE OF SUPPORTSTRUCTURE. PROVIDE SUPPLEMENTAL SUPPORT COMPONENTS AS REQUIRED FORPROPER INSTALLATION.2.HEIGHT SHALL FINISH A MINIMUM OF 8" ABOVE FINISHED ROOF SURFACE.NEW HDG POST 4-1/2" ODx 20" TALL WITH 5/8" THICKBASE PLATE5/8"Ø SS THREADEDRODS (4) (LENGTH VARIES)5/8" THICKBOTTOM PLATEEXISTINGBEAM/JOIST(DEPTH VARIES)WEB/JOISTSTIFFNERBOTH SIDES(IF REQUIRED)8"MIN.20"x20"x20 GA.DECK CLOSURE PLATE#10 SELF-TAPPINGSCREWS@ 8" O.C.ANCHOR POSTEYETHERMOPLASTICMEMBRANEHOT AIR WELDEXISTING METALDECKCOVERBOARDBASE LAYERINSULATIONTOP LAYERINSULATIONEXISTING THERMALBARRIERPRE-MOLDED PIPE BOOT PERDETAIL 10/3.0PERIMETER OF ROOF (16 FASTENERS)6"6"2'-0"2'-0"1'-0"12"1'-0"1'-0"1'-0"2'-0"PERIMETER OF ROOF (12 FASTENERS)NOTE:1.IF PART OF A BOARD FALLS WITHIN THE PERIMETER OR CORNER BOUNDARY, THAT ENTIRE SHEET MUST ALSO MEET THE FASTENING PATTERN REQUIRED FOR THAT AREA.2.FASTENING PATTERN SHOWN IS MINIMUM REQUIREMENTS. THE CONTRACTOR IS RESPONSIBLE FOR PROVIDING ENHANCED PATTERNS IF REQUIRED BY THE MANUFACTURER.CORNER OF ROOF (20 FASTENERS)1'-0"1'-0"6"1'-6"1'-0"1'-0"8" MIN.2"112"6"EXISTING EQUIPMENT - SECURE WITH 2FASTENERS PER SIDE.TERMINATIONBAR FASTENED @8" O.C.MEMBRANE FLASHING, FULLY ADHEREDEXTEND OVER TOP OF CURBTHERMOPLASTIC MEMBRANEEXISTING TAPEREDINSULATIONEXISTING CURB. EXTENDWITH NEW BLOCKING IFNEEDED TO OBTAIN THE 8"MIN. HEIGHTHOT-AIR WELDEXISTING THERMALBARRIERGALVANIZED NAIL AT 3" O.C.EXISTING UNITTERMINATION BAR FASTENED AT 8" O.C.COUNTERFLASHINGSEALANTPOP RIVET AT 6" O.C.3"NON-REMOVABLE UNITEXISTING METALDECKCOVERBOARD -MECHANICALLYFASTENEDBASE LAYERINSULATIONTOP LAYERINSULATIONPOP RIVET 12" O.C.METAL FLASHING ON INTERIOR1"WRAP FLASHING UP AND UNDER SKIRTFLASHING. EXTEND PAST SKIRT FLASHING ANDTRIM.EXISTING ROOF HATCH CURBMEMBRANE FLASHING, FULLY ADHERED8" MIN.2"112"HOT AIR WELDTHERMOPLASTIC MEMBRANE4"EXISTINGTHERMAL BARRIEREXISTINGMETAL DECKPLATE AND FASTENERCOVERBOARD -MECHANICALLYFASTENEDBASE LAYERINSULATIONTOP LAYERINSULATIONEXISTING CURB - RAISE ASNECESSARY TO OBTAIN MINIMUMFLASHING HEIGHTNo.REVISIONByDateDRAWN BY:ENGINEER:APPROVAL:DATE:PROJ.:SCALE:DWG. NO.4.0RTKEWAS SHOWNCONSTRUCTION DETAILS 08/04/2020J2347KEW24SCALE: 3/4" = 1'-0"MINIMUM INSULATION FASTENING REQUIREMENTS3.0FALL PROTECTION234.0SCALE: 3" = 1'-0"ROOF HATCH224.0SCALE: 3" = 1'-0"CURB214.0SCALE: 3" = 1'-0"ORANGE COUNTY SPORTSPLEX MAIN BUILDING ROOF REPLACEMENT HILLSBOROUGH, NORTH CAROLINA ORANGE COUNTY ASSET MANAGEMENT SERVICES DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 352-(&70$18$/ )25 6325763/(;0$,1%8,/',1*522)5(3/$&(0(17 25$1*(&2817<+,//6%2528*+1& 3UHSDUHGIRU 25$1*(&2817<$66(70$1$*(0(17 :75<21675((7%%/'*5')/225 +,//6%2528*+1& 3UHSDUHGE\ $7/$6(1*,1((5,1*,1& $3</21'5,9( 5$/(,*+1257+&$52/,1$ $7/$6-2%12- $8*867 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 352-(&70$18$/ )25 6325763/(;0$,1%8,/',1*522)5(3/$&(0(17 25$1*(&2817<+,//6%2528*+1& 3UHSDUHGE\ $7/$6(1*,1((5,1*,1& $3</21'5,9( 5$/(,*+1257+&$52/,1$ $7/$6-2%12- 5RE7DWXP55&.HOOL:LOFR[3(55& 6U'HVLJQHU3ULQFLSDO(QJLQHHU 1RWH 7KLVGRFXPHQWLVH[FOXVLYHO\IRUWKHXVHRIWKHFOLHQWLQGLFDWHGDQGVKDOOQRWEHUHSURGXFHGH[FHSWLQ IXOOZLWKRXWWKHH[SUHVVHGZULWWHQSHUPLVVLRQRI$WODV(QJLQHHULQJ 6(712BBBBBBB DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 $'9(57,6(0(17)25%,'6 6HDOHGSURSRVDOVZLOOEHUHFHLYHGXQWLO30RQ2FWREHULQWKHRIILFHRI 2UDQJH &RXQW\ )LQDQFH 0HDGRZODQGV 'ULYH +LOOVERURXJK 1RUWK &DUROLQD $WWQ2UDQJH&RXQW\3XUFKDVLQJIRUWKHFRQVWUXFWLRQRIWKH6SRUWVSOH[0DLQ%XLOGLQJ5RRI 5HSODFHPHQW%LGVZLOOEHSXEOLFO\RSHQHGDQGUHDGVWDUWLQJDW30LQWKH3DUNLQJ/RWDW 0HDGRZODQGV'ULYH+LOOVERURXJK1& %LGVZLOOEHUHFHLYHGIRUD6LQJOH3ULPH&RQWUDFW.$OOSURSRVDOVVKDOOEHOXPSVXP $PDQGDWRU\3UH%LGPHHWLQJZLOOEHKHOGIRUELGGHUVRQ7KXUVGD\6HSWHPEHUDW DPDWWKH2UDQJH&RXQW\6SRUWVSOH[%LGGHUVPD\RQO\YLVLWWKHVLWHIROORZLQJWKHPHHWLQJE\ DSSRLQWPHQWRQO\,QWHUHVWHGVXEFRQWUDFWRUVDQGVXSSOLHUVDUHVWURQJO\HQFRXUDJHGWRDWWHQG &RPSOHWHSODQVDQGVSHFLILFDWLRQVIRUWKLVSURMHFWFDQEHREWDLQHGIURPAtlas Engineering, Inc., 551-A Pylon Drive, Raleigh, North Carolina 27606, (919) 420-7676 Attn: Rob Tatum, RRC GXULQJQRUPDORIILFHKRXUVDIWHU6HSWHPEHU(OHFWURQLFGRFXPHQWVDUHSURYLGHGDWQR FRVW3ODQGHSRVLWRI2QHKXQGUHGGROODUVLQFDVKRUFHUWLILHGFKHFNLVUHTXLUHGIRU KDUGFRS\VHWV 7KHVWDWHUHVHUYHVWKHXQTXDOLILHGULJKWWRUHMHFWDQ\DQGDOOSURSRVDOV 6LJQHG 2UDQJH&RXQW\ Owner) DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 127,&(72%,''(56 6HDOHGSURSRVDOVZLOOEHUHFHLYHGXQWLO30RQ7%'LQWKHRIILFHRI2UDQJH&RXQW\$VVHW 0DQDJHPHQW : 7U\RQ 6WUHHW % %XLOGLQJ UG )ORRU +LOOVERURXJK 1RUWK &DUROLQD $WWQ$QJHO%DUQHVIRUWKHIXUQLVKLQJRIODERUDQGPDWHULDODQGHTXLSPHQWHQWHULQJLQWR WKHFRQVWUXFWLRQRIWKH6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW%LGVZLOOEHSXEOLFO\ RSHQHG DQG UHDG VWDUWLQJ DW 30 LQ WKH &RQIHUHQFH 5RRP DW : 0DUJDUHW /DQH +LOOVERURXJK1&7KHSURMHFWLQFOXGHVWKHUHSODFHPHQWRIDSSUR[LPDWHO\VTXDUH IHHWRI%DOODVWHG(3'0URRIV\VWHPZLWKQHZVLQJOHSO\URRIV\VWHP %LGVZLOOEHUHFHLYHGIRUD6LQJOH3ULPH&RQWUDFW$OOSURSRVDOVVKDOOEHOXPSVXP 3UH%LG0HHWLQJ $QRQPDQGDWRU\SUHELGPHHWLQJZLOOEHKHOGIRUELGGHUVRQ7%'DWSPDWWKHORFDWLRQ 7%'7KHPHHWLQJZLOODGGUHVVWKHSURMHFWVFRSHDQGGHVFULSWLRQDQGDQVZHUVSHFLILFTXHVWLRQV DQGLVVXHVDQWLFLSDWHGSURMHFWVFKHGXOHELGGLQJSURFHGXUHVDQGELGIRUPV3DUWLFLSDQWVZLOODOVR EHDEOHWRYLVLWWKHEXLOGLQJVLWHDQGURRIIROORZLQJWKHDGPLQLVWUDWLYHSRUWLRQRIWKHPHHWLQJ ,QWHUHVWHGVXEFRQWUDFWRUVDQGVXSSOLHUVDUHVWURQJO\HQFRXUDJHGWRDWWHQG &RPSOHWHSODQVVSHFLILFDWLRQVDQGFRQWUDFWGRFXPHQWVZLOOEHRSHQIRULQVSHFWLRQLQWKH RIILFHVRI2UDQJH&RXQW\$VVHW0DQDJHPHQWDQG$WODV(QJLQHHULQJ,QFDW$3\ORQ 'ULYH5DOHLJK1&DQGLQWKHHOHFWURQLFSODQURRPVRI$VVRFLDWHG*HQHUDO&RQWUDFWRUVL VTIW):'RGJHDQG&RQVWUXFW&RQQHFW (OHFWURQLFFRSLHVRIWKHGRFXPHQWVDUHDYDLODEOHDWQRFRVW+DUGFRSLHVRIWKHGRFXPHQWVPD\ EHREWDLQHGXSRQGHSRVLWRIRQHKXQGUHGGROODUVLQFDVKRUFHUWLILHGFKHFN7KHIXOO SODQGHSRVLWZLOOEHUHWXUQHGWRWKRVHELGGHUVSURYLGHGDOOGRFXPHQWVDUHUHWXUQHGLQJRRGXVDEOH FRQGLWLRQZLWKLQWHQGD\VDIWHUWKHELGGDWH'HSRVLWIRURQHVHWZLOOEHZDLYHGIRU%LGGHUV DWWHQGLQJWKH3UH%LG0HHWLQJ $OOFRQWUDFWRUVDUHKHUHE\QRWLILHGWKDWWKH\PXVWKDYHSURSHUOLFHQVHDVUHTXLUHGXQGHUWKHVWDWH ODZVJRYHUQLQJWKHLUUHVSHFWLYHWUDGHV *HQHUDOFRQWUDFWRUVDUHQRWLILHGWKDW&KDSWHU$UWLFOH*HQHUDO6WDWXWHVRI1RUWK&DUROLQD ZLOOEHREVHUYHGLQUHFHLYLQJDQGDZDUGLQJJHQHUDOFRQWUDFWV*HQHUDOFRQWUDFWRUVVXEPLWWLQJ ELGVRQWKLVSURMHFWPXVWKDYHOLFHQVHFODVVLILFDWLRQIRU8QOLPLWHG%XLOGLQJRU6SHFLDOW\5RRILQJ (DFKSURSRVDOVKDOOEHDFFRPSDQLHGE\DFDVKGHSRVLWRUDFHUWLILHGFKHFNGUDZQRQVRPHEDQNRU WUXVWFRPSDQ\LQVXUHGE\WKH)HGHUDO'HSRVLW,QVXUDQFH&RUSRUDWLRQRIDQDPRXQWHTXDOWRQRW OHVVWKDQILYHSHUFHQWRIWKHSURSRVDORULQOLHXWKHUHRIDELGGHUPD\RIIHUDELGERQGRIILYH SHUFHQWRIWKHELGH[HFXWHGE\DVXUHW\FRPSDQ\OLFHQVHGXQGHUWKHODZVRI1RUWK&DUROLQDWR H[HFXWHWKHFRQWUDFWLQDFFRUGDQFHZLWKWKHELGERQG6DLGGHSRVLWVKDOOEHUHWDLQHGE\WKHRZQHU DVOLTXLGDWHGGDPDJHVLQHYHQWRIIDLOXUHRIWKHVXFFHVVIXOELGGHUWRH[HFXWHWKHFRQWUDFWZLWKLQWHQ GD\VDIWHUWKHDZDUGRUWRJLYHVDWLVIDFWRU\VXUHW\DVUHTXLUHGE\ODZ $SHUIRUPDQFHERQGDQGDSD\PHQWERQGZLOOEHUHTXLUHGIRURQHKXQGUHGSHUFHQWRIWKH FRQWUDFWSULFH 3D\PHQWZLOOEHPDGHEDVHGRQQLQHW\ILYHSHUFHQWRIPRQWKO\HVWLPDWHVDQGILQDOSD\PHQW PDGHXSRQFRPSOHWLRQDQGDFFHSWDQFHRIZRUN DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 1RELGPD\EHZLWKGUDZQDIWHUWKHVFKHGXOHGFORVLQJWLPHIRUWKHUHFHLSWRIELGVIRUDSHULRGRI GD\V 7KHRZQHUUHVHUYHVWKHULJKWWRUHMHFWDQ\RUDOOELGVDQGWRZDLYHLQIRUPDOLWLHV 'HVLJQHU2ZQHU Atlas Engineering, Inc. Orange County 551-A Pylon Drive, Raleigh, NC 27604 Asset Management (919) 420-7676 300 W. Tryon Street, B Bldg, 3rd Floor PM- Rob Tatum: (919) 819-2811 (M) Hillsborough, NC 27278 Rob@atlasnc.com PM-Angel Barnes: (919) 245-262 abarnes@orangecountync.gov DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 7$%/(2)&217(176 7,7/(3$*( $GYHUWLVHPHQWIRU%LGV 1RWLFHWR%LGGHUV 7$%/(2)&217(176 x*HQHUDO&RQGLWLRQVRIWKH&RQWUDFWIRU&RQVWUXFWLRQ x*XLGHOLQHVIRU5HFUXLWPHQWDQG6HOHFWLRQRI0LQRULW\%XVLQHVVHVLQFOXGLQJ)RUPV x2UDQJH&RXQW\/LYLQJ:DJH3ROLF\ x2UDQJH&RXQW\0LQLPXP,QVXUDQFH5HTXLUHPHQWV x'LVSXWH5HVROXWLRQ5XOHVDQG3URFHGXUHVIRU2UDQJH&RXQW\'HVLJQ %XLOGLQJ&RQVWUXFWLRQ5HQRYDWLRQDQG5HSDLU3URMHFWV x+RWZRUN3HUPLW3URJUDP ',9,6,21*(1(5$/5(48,5(0(176 6XPPDU\RI:RUN %DVH%LG$OORZDQFHV(VWLPDWHG4XDQWLWLHV 3URMHFW0HHWLQJV 6XEPLWWDOV 4XDOLW\&RQWURO &RQVWUXFWLRQ)DFLOLWLHV 0DWHULDOVDQG(TXLSPHQW 3URMHFW&ORVHRXW ',9,6,216,7(:25. 6HOHFWLYH'HPROLWLRQ ',9,6,21:22'$1'3/$67,&6 5RXJK&DUSHQWU\ ',9,6,217+(50$/$1'02,6785(3527(&7,21 7KHUPRSODVWLF6LQJOH3O\5RRI0HPEUDQH 5RRI)ODVKLQJDQG6KHHW0HWDO 5RRI$FFHVVRULHV ',9,6,21),1,6+(6 3DLQWLQJ ',9,6,21±(48,30(17 )DOO3URWHFWLRQ6\VWHPV ',9,6,213/80%,1* 5RRI'UDLQV ',9,6,210(&+$1,&$/ *HQHUDO0HFKDQLFDODQG(OHFWULFDO5HTXLUHPHQWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &2175$&7)2506$1'%,'5(48,5(0(176 x)RUPRI3URSRVDO x)RUPRI%LG%RQG x6DIHW\4XHVWLRQQDLUHIRU)RUPDO%LGV x6KHHWIRU$WWDFKPHQWRI/LYLQJ:DJH&HUWLILFDWLRQ x)RUPRI&RQVWUXFWLRQ&RQWUDFW2QHQHHGHGIRU3URMHFWV2YHU x)RUPRI3HUIRUPDQFH%RQG x)RUPRI3D\PHQW%RQG '5$:,1*6 &29 &RYHU6KHHWZLWK%XLOGLQJ&RGH6XPPDU\ 5RRI3ODQ &RQVWUXFWLRQ'HWDLOV &RQVWUXFWLRQ'HWDLOV &RQVWUXFWLRQ'HWDLOV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 1 Revised 12/18 EXHIBIT 1----GENERAL CONDITIONS Table of Contents Page Article 1. Definitions......................................................................................................................3 Article 2. Correlation, Interpretation, and Intent of Contract Documents……...............................7 Article 3. Familiarity with Work, Conditions and Laws..................................................................8 Article 4. Bonds............................................................................................................................9 Article 5. Insurance and Indemnity ..............................................................................................9 Article 6. Other Record Documents and Submittals...................................................................16 Article 7. Contractor....................................................................................................................18 Article 8. Owner .........................................................................................................................26 Article 9. Construction Manager ................................................................................................26 Article 10. Designer ...................................................................................................................26 Article 11. Testing and Surveying..............................................................................................27 Article 12. Separate Contracts...................................................................................................27 Article 13. Contract Time ..........................................................................................................28 Article 14. Changes in the Work ...............................................................................................31 Article 15. Change of the Contract Price ..................................................................................33 Article 16. Unforeseen Conditions.............................................................................................35 Article 17. Correction of Work before Final Payment ...............................................................35 Article 18. Correction of Work after Substantial Completion; Warranties and Guaranties........36 Article 19. Owner's Right to Do Work .......................................................................................37 Article 20. Partial Payments .....................................................................................................37 Article 21. Final Payment..........................................................................................................40 Article 22. Contractor, Subcontractor and Supplier Affidavit ....................................................41 Article 23. Assignments and Subcontracts................................................................................41 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 2 Revised 12/18 Article 24. Measurements........................................................................................................41 Article 25. Contractor and Subcontractor Relationships..........................................................42 Article 26. Use of Premises .....................................................................................................42 Article 27. Cutting, Patching and Fitting ..................................................................................42 Article 28. Dispute Resolution ................................................................................................43 Article 29. Taxes......................................................................................................................43 Article 30. Operation of Owner's Facilities...............................................................................44 Article 31. Third Party Beneficiary Clause...............................................................................44 Article 32. Measurement of Quantities ....................................................................................44 Article 33. Termination by the Owner for Cause .....................................................................44 Article 34. Termination or Suspension by the Owner for Convenience...................................45 Article 35. Minority Business Enterprise Program……………………….……………………….46 Article 36 E-Verify, Iran Divestment, Israel Boycott, and Digital.……………………………..46 Article 37. General...................................................................................................................46 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3 Revised 12/18 ARTICLE 1. DEFINITIONS 1.1 Agreement - The Construction Contract, these General Conditions, and any Supplementary Conditions. 1.2 AIA - The American Institute of Architects. 1.3 ASTM - The American Society for Testing and Materials. 1.4 Beneficial Occupancy – Use of the Project by the Owner after Substantial Completion, but prior to Final Completion.. 1.5 Change Order - A written order to the Contractor signed by the Owner and the Designer authorizing an addition, deletion, or revision in the Work and/or an adjustment in the Contract Price and/or the Contract Time issued after execution of the Construction Contract. See paragraph 14.1. 1.6 Completion Date - Those dates identified as Completion Dates in the Contract Construction Schedule or elsewhere in the Contract Documents. 1.7 Construction Contract – The document executed by the Contractor and the Owner to formally memorialize their consent to the terms of the Agreement. 1.8 Construction Change Directive – A written order to the Contractor signed by the Owner and the Designer directing an addition, deletion, or revision in the Work after execution of the Construction Contract, in circumstances when the parties have been unable to agree on an adjustment to the Contract Price or the Contract Time, but the Owner requests that the Contractor proceed with said addition, deletion, or revision in the Work subject to adjustment of the Contract Price and/orContract Time under the procedures described herein. 1.9 Construction Manager(s) - The person(s) or firm designated as the Construction Manager in the Contract Documents, or their authorized representatives. The Construction Manager(s), as referred to herein, will be referred to hereinafter as if each were of the singular number and masculine gender. 1.10 Contract Construction Schedule - That schedule described in Article 13 hereof and identified as the Contract Construction Schedule. 1.11 Contract Documents - All of the documents that make up the Agreement, plus the Drawings and Specifications that describe the scope of the Work, plus allowable Modifications to the Contract Documents. 1.12 Contract Price - The total monies payable to the Contractor under the Contract Documents pursuant to paragraph 15.1 of the Agreement. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 4 Revised 12/18 1.13 Contract Time - The number of calendar days stated in, or computed from, the Contract Documents for the completion of the Work, or any portion thereof. See, particularly, Article 13 hereof and the Contract Construction Schedule. Time of completion as specified therein is of the essence. The time used and referred to on the Project will be that time which is observed in Raleigh, North Carolina, being Eastern Daylight Savings Time (EDT), Eastern Standard Time (EST), or other as designated by the Designer. 1.14 Contractor - The Contractor shall be that party identified as such in the Contract Documents. 1.15 Days - Unless otherwise indicated, the term "days" shall mean consecutive calendar days. 1.16 Daylight Hours - The hours or portions of hours between sunrise and sunset local time. 1.17 Designer(s) – The person or firm designated as the Designer in the Contract Documents, or their authorized representatives. The Designer(s), as referred to herein, shall mean architect, landscape architect, and/or engineer. They will be referred to hereinafter as if each were of the singular number and masculine gender. On projects for which there is no Designer designated references to approvals or authorizations of or by the Designer shall be interpreted to refer to approvals or authorizations of Owner or Owner’s designee. 1.18 Drawings - The Drawings are the graphic and pictorial portions of the Contract Documents, wherever located and whenever issued, showing the design, location, and dimensions of the Work, and generally including plans, elevations, sections, details, schedules and diagrams. A list of the Drawings is contained in the Contract Documents. 1.19 Field Order - A written order issued by the Designer which clarifies or interprets the Contract Documents or orders minor changes in the Work in accordance with the Contract Documents. See paragraph 14.2. 1.20 Final Completion - The point at which the Contractor has completed the Work, with the exception of guaranty and warranty obligations and as determined by the Designer and becomes entitled to final payment upon the recommendation of the Designer and determination by the Owner. 1.21 The words "furnish," "furnish and install," "install," and "provide" or words with similar meanings shall be interpreted, unless otherwise stated, to mean furnish and install complete, in place and ready for service. 1.22 Liquidated Damages – See paragraph 13.18 of these General Conditions. 1.23 Modification - (A) a written amendment to the Contract Documents signed by the Owner and the Contractor and identified therein as such, (B) a Change Order, (C) Construction Change Directive, or (D) a Field Order. A Modification may only be issued after execution of the Agreement. 1.24 Notice of Award - The written notice by the Owner to the Contractor that the Contractor is the successful Bidder and that upon compliance with the conditions precedent to be fulfilled by DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 5 Revised 12/18 the Contractor within the time specified, the Owner will execute and deliver the Agreement to him. 1.25 Notice to Proceed - See paragraph 13.3. 1.26 Owner - The Owner is the person designated as such in the Agreement. 1.27 Owner's Representative - A person, or persons, authorized and employed by the Owner and designated from time to time by written notice to the Contractor to administer the Contract Documents, and to observe and monitor the Work on behalf of the Owner with authority and responsibility as herein specified. 1.28 Notice - The term "notice" or "written notice" as used herein shall mean and include all written notices, demands, instructions, and claims approvals and disapprovals furnished by the Owner or the Designer to obtain compliance with the requirements of the Contract Documents, as well as all written notices, demands, instructions and claims furnished by the Contractor as required by the Contract Documents. Where notice is required under the terms of the Contract Documents written notice shall always be required, and oral or "constructive" notice shall be insufficient and ineffective as notice. Email or other electronic delivery shall be insufficient and ineffective as notice unless specifically allowed by the Supplementary Conditions or a Modification to the Agreement. Written notice shall be deemed to have been duly served on the date that it is delivered in person to the individual or to a member of the firm, to an officer of the corporation for whom it is intended, to an authorized representative of such individual, firm, or corporation, or on the date that it is mailed by registered or certified mail, return receipt requested, addressed to the last business address of such individual, firm, or corporation known to the person giving the notice. Written notice may also be given by facsimile transmission, provided that proof of delivery is obtained. In the case of delivery in person, such delivery shall not be effective unless and until a written and signed receipt showing the date and time of delivery is obtained. 1.29 Project - The total construction of which the Work performed under the Contract Documents may be the whole or a part. 1.30 Project Expediter – As used herein, is an entity stated in the Contract Documents, designated to effectively facilitate scheduling and coordination of Work activities. For the purpose of a single prime contract, the single prime contractor is designated as the Project Expediter. For the purpose of a project involving separate prime contracts, the Contractor for general work shall be designated as the Project Expediter unless otherwise indicated in the Supplementary General Conditions. See paragraph 7.27. 1.31 Project Manager - That person designated by the Contractor in accordance with paragraph 7.2 who shall be in general charge of the Work and its performance and who shall have the authority set forth in the last sentence of paragraph 7.2. 1.32 Request for Information - A written communication from the Contractor to the Designer for any interpretation of, or information needed, required, or desired under the Contract Documents. The Owner reserves the right to determine the reasonable format and contents required for a Request for Information. In any Request for Information, the Contractor shall state a reasonable date by which a response is necessary in order to avoid delay in progress on the Work and shall DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 6 Revised 12/18 make such request sufficiently in advance of such date as to avoid any such delay. The Designer shall respond in writing to the Request for Information by the date stated by the Contractor unless he cannot reasonably do so, in which case he shall prior to that date notify the Contractor of the date by which he can reasonably respond. The Contractor shall not be entitled to any additional time for the completion of the Work or any portion thereof by reason of the Designer's failure to respond if he has not submitted his Request for Information sufficiently in advance to allow the Designer a reasonable time within which to respond. 1.33 Request for Payment - The form, in the form of AIA Document G702 (latest ed.) or other published document approved by Owner, which is to be used by the Contractor in requesting progress payments and which is to include a Schedule of Values as required by the Contract Documents and an affidavit of the Contractor that progress payments theretofore received from the Owner on account of the Work have been applied by the Contractor to discharge in full all the Contractor's obligations incurred in connection with Work covered by all prior applications for payment. See paragraph 20.2. 1.34 Resident Superintendent - That person designated by the Contractor in accordance with paragraph 7.2 who has day-to-day responsibility for the prosecution of the Work and the obtaining of proper materials and equipment, and adequate labor and who shall have the authority set forth in the last sentence of paragraph 7.2. 1.35 Schedule of Values - Any breakdown of the Contract Price which may be required by the Contract Documents, and designated as such. See paragraph 20.1. 1.36 Specifications - That portion of the Contract Documents consisting generally of the written requirements for materials, equipment, construction systems, standards, and workmanship for the Work and performance of related services. 1.37 Subcontractor - A person, firm, or corporation who has entered into a direct contract with the Contractor to perform any of the Work at the Project. 1.38 Submittal - Shop drawings, product data, samples, and other documents required by the Contract Documents to be submitted by the Contractor to the Designer. 1.39 Submittal Register - See paragraph 13.2 of these General Conditions. 1.40 Substantial Completion - The point at which the Work, and Work by other Contractors on or in connection with the Project, as determined by the Designer, is sufficiently complete in accordance with the Contract Documents that it can be beneficially occupied by the Owner, and the Work can be utilized by the Owner for its intended use, and all necessary permits and permissions for Beneficial Occupancy and utilization having been obtained by the Contractor. All operations and maintenance manuals, Owner training, and as-built drawings must be submitted prior to Substantial Completion being achieved. 1.41 Sub-subcontractor - A person or entity that has a direct or indirect contract with a Subcontractor to perform any of the Work at the Project. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 7 Revised 12/18 1.42 Work - The construction and services required by the Contract Documents, including all labor, materials, equipment, and services provided or to be provided by the Contractor to fulfill the Contractor’s obligations. 1.43 All references in the Contract Documents to the masculine shall be interpreted as including the feminine or neuter and all references in the Contract Documents to the singular or the plural shall be interpreted as including the other, as may be appropriate in the reasonable interpretation of the Contract Documents. ARTICLE 2. CORRELATION, INTERPRETATION AND INTENT OF CONTRACT DOCUMENTS 2.1 It is the intent of the Specifications and Drawings and other Contract Documents to describe a complete Project in accordance with the Contract Documents. 2.2 The Contract Documents are complementary; what is called for by one is as binding as if called for by all. If the Contractor finds a conflict, error or discrepancy in the Contract Documents, the Contractor shall notify the Designer in writing before proceeding with the Work affected thereby. In resolving such conflicts, errors and discrepancies, the Contract Documents shall be given preference in the following order: Construction Contract, Modifications, Addenda, General Conditions, Specifications, and Drawings. Figure dimensions on Drawings shall govern over scale dimensions, and detailed Drawings shall govern over general Drawings. Any Work that may reasonably be inferred from the Contract Documents as being required to produce the intended result shall be supplied whether or not it is specifically called for. Work, materials or equipment described in words which, so applied, have a well-known technical trade meaning shall be deemed to refer to such meaning and to incorporate any recognized standards which are a part of such meaning if not otherwise defined within the Contract Documents. 2.3 Miscellaneous items, accessories and work which are not specifically mentioned, but which are essential to produce a complete and properly operating installation, or useable structure or plant providing the indicated function shall be furnished and installed without change in the Contract Price. Such miscellaneous items and accessories shall be of the same quality standards, including material, style, finish, strength, class, weight and other applicable characteristics, as specified for the major component of which the miscellaneous item or accessory is an essential part, and shall be approved by the Designer before installation. This requirement is not intended to include major components not covered by or inferable from the Contract Documents. 2.4 The Work of all trades under the Contract Documents shall be coordinated by the Contractor in such a manner as to obtain the best workmanship possible for the entire Project and all components of the Work shall be installed or erected in accordance with the best practices of the particular trade. 2.5 The Contractor shall fully complete the Work and shall be responsible for all of the Work under the Contract Documents to which the Construction Contract applies. If the Contractor is prevented from doing so by any limitation of the Contract Documents, the Contractor shall immediately give notice thereof to the Designer and the Owner in writing. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 8 Revised 12/18 2.6 Standard specifications or manufacturers' literature, when referenced, shall be of the latest revision or printing unless otherwise stated and is intended to establish the minimum requirements acceptable. 2.7 For those materials specified without the use of brand names, the Contractor shall submit within thirty (30) days after his receiving the Construction Contract for signatures, any product that meets the express requirements of the Specifications. Such Submittal shall include manufacturer's data, test reports, performance data and certifications, samples, erection details, and other applicable information as required to permit determination by the Designer whether such proposed products are suitable. The Designer shall be the sole judge as to the suitability of any proposed product. The burden of proof of quality rests with the Contractor. 2.8 The Contractor is required to examine and read the complete set of Contract Documents for information concerning the Work, because some of the Work for which the Contractor will be responsible may be indicated on or in documentation applying primarily to the Work of one or more other separate prime contractors. No allowance will be made for the Contractor’s failure to become familiar with the complete set of project documents. 2.9 Contractor’s requests for clarification or information shall clearly define the cause(s) of Contractor’s request and, as appropriate, shall include Contractor’s interpretation and Contractor’s proposed solution. ARTICLE 3. FAMILIARITY WITH WORK, CONDITIONS AND LAWS 3.1 The Contractor has investigated prior to bidding and is satisfied with all conditions affecting the Work, including but not restricted to those bearing upon transportation, disposal, handling and storage of materials, availability of labor, water, electrical power, roads and uncertainties of weather, or similar physical conditions at the Project site, and the character of equipment and facilities needed prior to and during prosecution of the Work. The Contractor is satisfied as to the character, quality and quantity of surface and subsurface materials or obstacles to be encountered insofar as this information is reasonably ascertainable from inspection of the Project site, including all exploratory work done by the Owner, as well as from information presented by the Contract Documents, or any other information made available to the Contractor prior to receipt of bids. Any failure by the Contractor to become acquainted with the available information shall not relieve the Contractor from the responsibility for estimating properly the difficulty or cost of successfully performing the Work. 3.2 The Contractor shall be entitled to make all inferences from the Contract Documents that would reasonably be made by a contractor having knowledge and experience with similar work; however, the Contractor shall not be entitled to infer from the Contract Documents any fact or condition which would not be inferred by a contractor having knowledge and experience with similar work and the Contractor shall be required to obtain independently such other information as a knowledgeable and experienced contractor would prudently obtain in order to evaluate any such condition. 3.3 The Contractor specifically acknowledges familiarity with all Federal, State, and local laws, ordinances, rules, and regulations which may in any manner affect those engaged or employed in the Work, or the materials or equipment in or about the Work, or in any way affect the conduct of the Work and agrees that the Contractor and the Contractor’s employees, subcontractors, DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 9 Revised 12/18 and suppliers will, at all times, comply with same. If the Contractor shall discover any provisions in the Contract Documents which are contrary to or inconsistent with any such law, ordinance, rule, or regulation, the Contractor shall immediately give notice thereof to the Designer and the Owner in writing, identifying any items of Work affected, and the Contractor shall not proceed until the Contractor has received written direction from the Designer with respect to these items. If the Contractor performs contrary to or inconsistently with any such law, ordinance, rule, or regulation without such written direction, the Contractor shall bear all costs which are a consequence of such performance. 3.4 At times selected by the Designer after execution by the Contractor of the Construction Agreement, a pre-construction conference shall be scheduled and conducted for the benefit of the Project. ARTICLE 4. BONDS 4.1 A performance bond in the full amount of the Contract Price shall be required of the Contractor to guarantee the faithful performance of the Work in compliance with the Contract Documents, in such form as may be required by law and approved by the Owner. The bond shall be dated the same date as the Construction Contract and must be accompanied by a current copy of the power of attorney for the attorney-in-fact executing such bond on behalf of a surety company licensed to do business in the state of North Carolina. 4.2 A payment bond in the full amount of the Contract Price shall be required of the Contractor to guarantee the payment of all labor and material costs or claims in connection with compliance with the Contract. The payment bond shall be in such form as may be required by law and approved by the Owner. Said bond shall be dated and executed in the same manner as the performance bond in paragraph 4.1. ARTICLE 5. INSURANCE AND INDEMNITY 5.1 CONTRACTOR PROVIDED INSURANCE The Contractor shall, without limiting its obligations or liabilities, procure, pay for and maintain such insurance as is required by law and as is required by this Agreement to protect the Contractor and the Owner from claims for damages for bodily injury, including death, and from claims for property damage which may arise from the Contractor's or its representatives', consultants', Subcontractors', agents', or employees' operations under this Agreement. Such insurance shall be of the kinds and have limits of liability and coverages not less than the minimum limits hereinafter specified or required by law, whichever is greater. The Owner makes no representation as to the adequacy or sufficiency of such coverages. The following requirements shall in no way be construed to limit or eliminate the liability of the Contractor, which arises from performance of Work under the Agreement. The Contractor is strictly responsible for any losses, claims, and costs of any kind which exceed the Contractor's limits of liability, or which may be outside the coverage scope of the policies. The insurance specified shall be provided by an insurer approved by the Owner, authorized to do such business in the State of North Carolina, and on terms approved by the Owner. Insurance companies utilized shall have a minimum rating of A- and Class VII as evaluated by the most current A.M. Best Rating Guide. If the insurer has a Best Rating less than A- and Class VII, the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 10 Revised 12/18 Contractor must receive specific written approval from the Owner prior to proceeding with any Work under the Agreement. All agents and brokers shall hold valid licenses from the State of North Carolina. Before commencing mobilization to the Project site and not later than 7 days after the receipt of the Construction Contract by the Contractor for signatures, the Contractor shall furnish to the Owner a certificate or certificates of insurance in a form satisfactory to the Owner. Upon request of the Owner, the Contractor shall provide the Owner with certified copies of the insurance policies required by this Article, including without limitation declaration pages, conditions, exclusions and endorsements, and confirmation that each policy premium has been paid for the required term of this Agreement. A copy of the umbrella policy shall be provided to the Orange County Risk Manager. Certificates shall be signed by a person authorized by that insurer to bind coverage on its behalf. All insurance policies shall provide, as evidenced by Certificates of Insurance, that the insurance shall not be canceled, reduced, restricted, or changed in any way without at least 30 days prior written notice to the Owner. With regard to expiration, cancellation, reduction, restriction, or any other change, certificates shall state: "Should any of the following described policies be canceled before expiration date or be due to expire within 30 days, the insurer shall mail 30 days prior written notice to named certificate holder." In the event of any such cancellation, non-renewal, reduction, restriction, or change in any insurance, the Contractor is obligated to replace such insurance within 7 days without a gap in coverage and file accordingly such notice with the Owner, and other interested parties. Failing immediate receipt of evidence of such replacement of insurance the Owner reserves the right to procure such insurance as the Owner considers desirable and the Contractor shall pay or reimburse the cost of the premium in respect thereof. It is expressly provided, however, that any action or inaction on the part of the Owner in this respect shall in no way change or reduce the Contractor's responsibilities and liabilities under this Agreement. Self-funded, policy fronting, or other non-risk transfer insurance mechanisms are not acceptable without prior written approval of the Owner. Full disclosure of such a program must be made prior to commencing mobilization to the Project site. Failure to make a full disclosure constitutes a material breach of the Agreement, justifying termination for default. The Contractor shall name the Owner, the Designer, the Designer’s consultants, and the Construction Manager as additional insureds under all its insurance contracts (except workers' compensation) with respect to and including without limitation liability arising out of activities performed by or on behalf of the Contractor, products and completed operations of the Contractor, and automobiles owned, hired, leased, or borrowed by the Contractor. The coverage shall contain no special limitations on the scope of protection afforded to additional insureds. For any claims related to this Project, the Contractor's insurance or self-insurance shall be primary and noncontributory with respect to the Owner’s insurance. Any insurance or self - insurance maintained by the Owner shall be excess and noncontributory with respect to the Contractor's insurance. All policies of insurance shall contain a clause waiving rights of subrogation against the Owner, unless the Owner approves otherwise in writing. Limits of coverage are not to be amended by deductible clauses of any nature without the express written consent of the Owner. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 11 Revised 12/18 The Contractor shall be solely responsible for any deductible assumptions that may exist in any insurance policies required under this Agreement. In addition, the Contractor shall be responsible and shall not be reimbursed for any losses arising from any risk or exposure not insured as required herein, or not covered as a result of a normal policy exclusion or that falls within the self-insured retention, if Contractor self-insured. The Contractor's insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer's liability. The claim provisions in the Contractor’s insurance policies must specifically state the insurance company or Contractor’s Third Party Administrator, if self-insured, has both the right and duty to adjust a claim and provide defense. The policies shall not contain any provision or definition which would serve to exclude or eliminate from coverage third party claims, including exclusions of claims for bodily or other injury to shareholders, partners, officers, directors, or employees of the insured, the premises owner, real estate manager, or the insured's Subcontractor, or any family relative of such persons. If the policies contain any warranty stating that coverage is null and void (or words to that effect) if the Contractor does not comply with the most stringent regulations governing the Work, it shall be modified so that coverage shall be afforded in all cases except for the Contractor's willful or intentional noncompliance with applicable government regulations. Any failure by any person to comply with reporting or other provisions of the policy including breach of warranties, shall not affect coverage provided to the Owner and its representatives, officials, and employees. The insolvency or bankruptcy of the Insured or of the Insured's estate shall not relieve the insurance companies of their obligations under these policies. Any clauses to the contrary are unacceptable and must be stricken. Failure to comply with these requirements shall be a material breach of this Agreement justifying termination for default. 5.1.1 Worker's Compensation and Employers' Liability Insurance The Contractor and its Subcontractors shall procure and maintain Workers' Compensation Insurance in the amount and type required by the State of North Carolina and federal law for all employees employed under the Agreement who may come within the protection of Workers' Compensation Laws and covering all operations under the Agreement whether performed by the Contractor or by his Subcontractors. In jurisdictions not providing complete Workers' Compensation protection, the Contractor and his Subcontractors shall maintain employers' liability insurance in an amount, form, company, and agency satisfactory to the State of North Carolina and the Owner for the benefit of all employees not protected by Workers' Compensation Laws and covering all operations under the Agreement whether performed by the Contractor or by his Subcontractors. The Contractor shall pay such assessments as will protect the Contractor and the Owner from claims under the Workers' Compensation Laws, workers' or workmen's compensation disability benefits, and other similar employee benefit acts. The current Experience Modification Factor shall be indicated on the Certificate of Insurance. Coverage under this section shall be as required by federal and state Workers' Compensation and Occupational Disease Statutes, and shall have minimum limits as follows: Coverage A: Statutory, State of North Carolina Employers' Liability: Each Accident $1,000,000 Disease - Policy Limit $1,000,000 Disease - Each Employee $1,000,000 Such insurance shall include Voluntary Compensation coverage, a Waiver of Subrogation DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 12 Revised 12/18 in favor of the Owner as well as other endorsements that may be required by applicable jurisdictions. 5.1.2 Automobile Liability Insurance The Contractor shall procure and maintain automobile insurance against liability f or bodily injury and property damage as described below, that may arise with respect to the Work being performed under the Agreement, and as will provide protection from claims which may arise out of or result from the Contractor's performance of the Work and the Contractor's other obligations under the Agreement, whether such performance of the Work is by the Contractor, by any representative or Subcontractor, by anyone, both officially and personally, directly or indirectly employed by any of them, or by anyone for whose acts any of them may be liable. This policy of insurance shall carry the following minimum Limit of Liability: Combined Single Limit $1,000,000 per occurrence; Aggregate $2,000,000.00. The policy of insurance shall contain or be endorsed to include the following: a) owned, hired, and non-owned automobile liability. b) If the policy contains a warranty stating that coverage is null and void (or words to that effect) if the transporter does not comply with the most stringent regulations governing the Work, it shall be modified so that coverage shall be afforded in all cases except for the transporter's willful or intentional noncompliance with applicable government regulations. Any failure by any party to comply with reporting or other provisions of the policy including breach of warranties, shall not affect coverage provided to the Owner and its representatives, officials, and employees. No subcontracting of waste hauling shall be permitted without prior, written approval of the Owner. 5.1.3 General Liability This policy must be written on an Occurrence basis, with the following minimum Limits of Liability: General Aggregate per project $2,000,000.00 Products/Completed Operations Aggregate $2,000,000.00 Bodily Injury and Property Damage csl/each occurrence $1,000,000.00 Personal Injury and Advertising Injury $2,000,000.00 The policy of insurance shall contain or be endorsed to include the following: a) Blanket Contractual Liability covering Contractor’s indemnification obligations under this Agreement, in accordance with ISO policy form CG 00 01. Modifications to the standard provision will not be acceptable if they serve to reduce coverage. b) Premises/Operations Liability. c) Explosion, collapse, and underground fault. d) Independent Contractors and Independent Subcontractors coverage. e) Broad Form Property Damage. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 13 Revised 12/18 f) Personal Injury g) Cross Liability/Severability of Interest clause. h) Employer’s Stop-Gap Liability endorsement, if applicable. i) Amendment of the Pollution Exclusion Endorsement to allow coverage for bodily injury or property damage caused by heat, smoke, or fumes from a hostile fire. j) Designated General Aggregate Limit Endorsement if required by the Contract Documents. Coverage shall remain continuously in effect and without interruption for at least 6 years from the date of the Notice of Award and shall include coverage for exposures arising from operations that have been completed. The Contractor shall furnish the Owner and each other additional insured listed in the Agreement to whom the Certificates have been issued, evidence satisfactory to the Owner of continuation of such insurance at the date of Preliminary Acceptance and each year thereafter. 5.1.4 Pollution Legal Liability (PLL) Pollution Legal Liability coverage will be provided as follows: $1,000,000.00 per occurrence; Aggregate $2,000,000.00. 5.1.5 Umbrella Liability The Contractor shall maintain an occurrence basis (as distinguished from a ―claims made‖ basis) Umbrella Liability policy (true follow form) over the underlying General Liability, Automobile Liability, and Employer's Liability, with the following limits of liability: Each Occurrence $3,000,000, Aggregate $3,000,000. On a fully insured basis such coverage will be subject to a deductible no greater than $10,000 per occurrence where coverage is not provided by the underlying insurance, but is provided by the Umbrella Liability policy. The Contractor may use any combination of primary and umbrella insurance policies to comply with the insurance requirements, provided the resulting insurance is equivalent to the insurance stated herein. All Occupational Disease exclusions must be deleted. Any Pollution Exclusion must be amended to allow coverage for bodily injury or property damage caused by spill, upset, overturn, heat, smoke, or fumes from a hostile fire. 5.1.6 Property Insurance The Contractor shall purchase All Risk Property Insurance on a Completed Value Form in the names of the Owner, Contractor, Subcontractors, and sub-subcontractors as their interests may appear with limits as follows: a) Full insurance value of the Work, or b) Amount equal to the Contract Price for the Work, whichever is higher. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 14 Revised 12/18 The Contractor is responsible for all physical damage to owned or rented machinery, tools, equipment, forms, and other items owned, rented or used by the Contractor and/or Subcontractor(s) in the performance of the Work including all of Owner’s property in Contractor’s care, custody, or control, and all such property while it is in transit. The insurance coverage evidencing such shall include a waiver of subrogation in favor of the Owner. 5.1.7 Valuable Papers and Records The Contractor shall provide valuable papers and records insurance with coverage in an amount commensurate with project scope and set forth in the Supplementary General Conditions. 5.1.8 Claims The Contractor shall notify the Owner within 24 hours of any claims or alleged claims received by the Contractor covered by any of the policies of insurance required in this Agreement. The Contractor shall provide a written copy of the claim or alleged claim to the Owner within 3 days of the Contractor's receipt of the claim or alleged claim. If a claim is settled to the satisfaction of the claimant, the Contractor shall submit a copy of the claimant's release to the Owner. If a claim or alleged claim is rejected by the Contractor and/or its insurance company, the Contractor shall immediately report this fact to the Owner. Should 30 days elapse after the claim or alleged claim has been received by the Contractor, and the Contractor is not able to report a settlement or rejection of the claim, it shall report to the Owner the steps being taken with respect to the claim. Without limiting the foregoing, the Contractor shall notify in writing the county risk manager of any paid or incurred claims which may impair annual aggregate or general liability. 5.1.9 Deductibles and Self-insured Retentions Any deductibles or self-insured retentions must be declared to and approved by the Owner. At the option of the Owner, either: a) the insurer shall reduce to a maximum of $250,000 or eliminate such deductibles or self-insured retentions with respect to the Owner, or (b) the Contractor shall provide evidence of collateral provided to insurers or procure a bond guaranteeing payment of losses and related investigations, claim administration, and defense expenses within the deductible or self-insured retention amount. Any self-insured retention or deductible amount on the policy shall not reduce the amount of collectible limits or liability. 5.1.10 Subcontractors The Contractor shall include all Subcontractors as Insureds under its policies, or shall furnish separate certificates, policies, and endorsements for each Subcontractor the Contractor intends to use. If a Subcontractor does not take out insurance in his own name and the Contractor wishes to provide insurance protection for such Subcontractor and such Subcontractor's employees, the Contractor shall either (a) procure appropriate policies in the name of the Subcontractor, or (b) cause a rider or riders to be attached to the Contractor's policies which shall identify the Subcontractor thereby covered; provided, however, in the case of the latter option, such a rider need not be attached to the Contractor's workers' compensation policy if such policy by its terms is sufficiently broad to cover the employees of all Subcontractors performing Work under the Contract Documents. Except as otherwise approved by the Owner in writing, Limits of Liability and coverage scope must be at a minimum as stringent as required of the Contractor by the Contract Documents. All Work performed for the Contractor by any DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 15 Revised 12/18 Subcontractor shall be pursuant to an appropriate agreement between the Contractor and the Subcontractor which shall contain provisions that waive all rights the contracting parties may have against one another for damages caused by fire or other perils covered by insurance as provided herein. Insurance monies received from any loss shall be divided as the respective interest of the parties affected shall appear. 5.2 OWNER CONTROLLED PROJECT SPECIFIC INSURANCE In the event the Owner elects to purchase project-specific insurance affording coverage to the Contractor and Subcontractors, the terms and conditions of such coverage shall be set forth in the Supplementary Conditions. 5.3 CONTRACTOR AS JOINT VENTURE If the Contractor is completing this Project on a joint venture basis, both joint venture partners retain all liabilities assumed by this Agreement, individually and collectively. This may include, but is not limited to, all premiums due, deductibles/self-insured retentions, coinsurance provisions, claim provisions, insurance policy conditions, and indemnification provisions hereunder. Evidence of a Blanket Joint Venture Endorsement must be obtained from the General Liability and Contractor's Pollution Legal Liability carriers of each joint venture partner for a period of 6 years after completion of the Project, substantially as follows: With respect to "your work", and the "products-completed operations hazard", you are an insured for your liability arising out of the conduct of any partnership or joint venture of which you were a partner or member, even though this partnership or joint venture is not shown as a Named Insured in the Declarations. This coverage is excess over any available liability purchased specifically to insure the partnership or joint venture. This coverage will not inure to the benefit of any other party except you." 5.4 INDEMNIFICATION The Contractor, to the fullest extent not expressly prohibited by law, shall defend, indemnify, and save harmless the Owner, the Designer, the Construction Manager and their respective officials, officers, employees, and agents from and against any and all liabilities (foreseeable or unforeseeable), penalties, fines, liens, forfeitures, demands, claims, causes of actions, suits, judgments, and costs and expenses incidental thereto, (including, without limitation, amounts paid pursuant to investigations, defense or settlements, and reasonable attorneys' fees), which any or all of them may hereafter suffer, incur, be responsible for, or pay out as a result of but not limited to: a) bodily injury (including sickness, disease, or death) to any person including but not limited to, the Contractor's employees or its representatives while on the site of the Project; or b) actual or alleged damage (including loss of use) to any property (public or private, including the Project or other property on the Project site); or c) contamination of or adverse effects on the environment arising directly or indirectly out of or in connection with the performance of the Work, including but not limited to any hazardous or toxic waste, substance, or constituent of any substance subject to regulation under CERCLA, RCRA, TSCA, and other Federal and state authorities that is spilled, released, threatening to DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 16 Revised 12/18 release, or disposed of or destroyed by the Contractor or its Subcontractors on or off the site of the Project or while in transport to or from the site; or d) any violation or alleged violation of laws and regulations, arising out of or in any way connected with the Work, caused in whole or in part by the Contractor, any Subcontractor or supplier or any representatives of the Contractor. The Contractor shall not be required to indemnify the Owner against losses resulting from a breach of this Agreement by the Owner or its other agents and contractors, or resulting from negligence, misconduct or violation of laws on the part of the Owner or its other agents and contractors. e) upon completion of the Work the Contractor shall execute an affidavit, indemnification, and release stating there are no unpaid debts for any work that has been done or materials that have been furnished to the Project prior to and as of the date of substantial completion and further stating that Contractor shall indemnify, save and protect Owner and Owner’s lender, if any, harmless from and against any and all claims, liabilities, liens, losses, damages, causes of action, and expenses (including court costs and reasonable attorney’s fees related thereto) arising out of, in connection with, or resulting from any such claims, liabilities, liens, losses, damages, causes of action, or expenses. Such affidavit, indemnification, and release shall be in a form and substance acceptable to Owner. By executing this Agreement Contractor acknowledges the receipt of adequate consideration in return for said release. The Contractor further agrees to obtain, maintain, and pay for such liability insurance coverages and endorsements as will insure the provisions of this paragraph 5.4. Furthermore, the Contractor agrees to be liable for and to indemnify and reimburse the Owner for all legal fees and disbursements paid or incurred to enforce the provisions of this paragraph. The indemnification obligations under this paragraph shall not be limited in any way by the amount or type of damages, compensation or benefits payable under worker's compensation acts, disability benefit acts, other employment benefit acts, or the amount of insurance carried or recovered. The Owner acknowledges that hazardous or toxic waste, material, chemicals, compounds or substances, or other environmental hazards, contamination or pollution, (referred to hereinafter as ―environmental hazards‖) may be present at the Project site that were not created, generated, or released at the Project site by the Contractor or its Subcontractors, agents or employees, acting alone or in concert with others. Unless the remediation, abatement or handling of such environmental hazards is part of the scope of the Work under this Agreement, then upon the discovery of such environmental hazards, the Contractor shall immediately, and in no event more than three days later, give notice to the Owner of the environmental hazards before they are disturbed. The Owner and the Designer shall thereupon promptly investigate the environmental hazards, and make such changes in the Drawings and/or Specifications as they may find necessary to abate, remediate, isolate or handle the environmental hazards. Any increase or decrease in the Contract Price or the Contract Time resulting from such changes shall be adjusted in the manner provided herein for adjustments as to extra and/or additional Work and changes. It is agreed that the Contractor shall have no liability under this Agreement for any environmental hazards existing prior to the date that Work commences under this Agreement unless the Contractor or its Subcontractors, agents or employees, acting alone or in concert with others, by their own negligence or misconduct, release or expose the Owner or third parties to the environmental hazards. The provisions of this paragraph shall survive the termination or cancellation or completion of this Agreement. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 17 Revised 12/18 5.5 RISK MANAGEMENT POLICY The Orange County Risk Management Policy shall not apply to construction contracts for amounts over $250,000. The terms of these General Conditions related to insurance shall be the sole authority governing insurance requirements for such contracts. ARTICLE 6. OTHER RECORD DOCUMENTS AND SUBMITTALS 6.1 The Designer shall furnish to the Contractor the number of copies of Drawings and Specifications stated in the Contract Documents. Additional copies of Drawings and Specifications may be obtained at the cost of reproduction and handling. 6.2 The Contractor shall submit to the Designer all Submittals required by the Contract Documents. The Contractor shall submit at least three (3) reproducible prints of all shop drawings. The Contractor shall submit samples in quantities required by the Contract Documents. The Contractor shall submit product data in at least five (5) copies. All shop drawings shall be reviewed by the Contractor and shall bear the Contractor's stamp of approval before being forwarded to the Designer. Submittals shall be submitted in such time as to cause no delay to the Work or any part thereof and in accordance with the Contract Construction Schedule and Submittal Register. The Designer shall review the submittal with reasonable promptness, noting desired corrections, if any. The Designer shall retain two (2) copies of the submittal and shall return the balance of the reviewed submittal to the Contractor for action. The Contractor shall furnish any corrected submittal to the Designer. The Designer shall retain two (2) copies of the corrected submittal and will return the balance of the reviewed submittal to the Contractor. All substitutions prior to the receipt of bids shall be in accordance with the Contract Documents. Refer to Instructions to Bidders, Substitutions. The Contractor acknowledges that the processing of shop drawings and other submittals is directly impacted by the clarity, completeness, and accuracy of said documents and that it is the Contractor’s responsibility to (i) review and coordinate each submittal with all other related or affected Work and (ii) approve each submittal before submitting same to the Designer for approval. 6.3 No substitutions and no deviations from any requirement of the Contract Documents shall be deemed allowed unless the Contractor has specifically informed the Designer and the Owner in writing of such deviations at the time of submittal and the Designer and the Owner have given written and specific approval to the substitutions or deviations. In proposing a deviation or substitution the Contractor warrants to the Owner, notwithstanding any review, allowance or approval by the Designer or the Owner that the deviation or substitution is at least equal to or better in quality and for the purpose intended, and that Contractor shall not by reason of any such review, allowance or approval be relieved from any obligation or responsibility contained in the Contract Documents. 6.4 Review of submittal by the Designer shall not be construed as relieving the Contractor from responsibility for compliance with terms or designs of the Contract Documents nor from responsibility for errors of any sort in the submittal. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 18 Revised 12/18 6.5 The Contractor shall keep one record copy marked "As-Built" of all Specifications, Drawings, Addenda, Modifications, and Submittals at the Project in good order and annotated at least monthly to show all changes made during the construction process. Such monthly annotations and their approval by the Designer shall be a condition precedent to approval by the Designer of each monthly Request for Payment. Said record copy shall be stored at the Project and fully protected from damage by fire or other hazard. This record copy shall be available to the Designer and Owner for inspection at all times and shall be delivered to the Designer for the Owner's purposes prior to the Designer's certifying Substantial Completion of the Work. 6.6 At completion of the Project and before Final Payment, the Contractor shall assemble and deliver to the Owner one complete set of all as-built drawings and one complete set of all approved submittals, product data, and samples which were reviewed by the Designer. These drawings and submittals shall be on paper, or in electronic or other media if required by the Supplementary Conditions. These drawings and submittals shall be categorized and packaged as directed by the Designer. ARTICLE 7. CONTRACTOR 7.1 The Contractor shall supervise and direct the Work efficiently and with the Contractor’s best skill and attention. Except as may be set forth specifically in the Contract Documents, the Contractor shall be solely responsible for the means, methods, techniques, sequences, and procedures of construction, and for safety precautions and programs in connection with the Work. The Contractor shall be responsible to see that the finished Work complies accurately with the Contract Documents. 7.2 The Contractor shall appoint a Project Manager and shall keep on the Project at all times during its progress a competent Resident Superintendent and necessary assistants who shall not be replaced without prior written approval by the Owner except under extraordinary circumstances, in which event immediate written notice shall be given to the Designer and the Owner. The Project Manager and the Resident Superintendent may be the same person or different persons. At any time, the Owner, in its sole and absolute discretion, may require the Contractor to replace the Project Manager or Resident Superintendent with an experienced and competent person or persons upon seven (7) days written notice from the Owner to the Contractor. Such replacement shall be at the Contractor's expense and at no cost to the Owner. Both the Project Manager and the Resident Superintendent shall have authority to act on behalf of the Contractor, and instructions, directions or notices given to either of them shall be as binding as if given to the Contractor. 7.3 The Contractor shall provide sufficient competent and suitably qualified personnel, equipment, and supplies to lay out the Work and perform construction as required by the Contract Documents. The Contractor will at all times maintain good discipline and order at the site, and will comply with all applicable OSHA standards. Any person employed by the Contractor, any Subcontractor, or any sub-subcontractor who, in the opinion of the Designer or the Owner, does not perf orm his Work in a proper and skillful manner or is intemperate or disorderly shall, at the written request of the Owner or Designer, be removed forthwith by the Contractor, Subcontractor, or sub-subcontractor employing such person without cost to the Owner, and shall not be employed again in any portion of the Work without the written approval of the Owner or Designer. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 19 Revised 12/18 Should the Contractor fail to remove such person or persons or fail to furnish suitable and sufficient personnel for the proper prosecution of the Work within three (3) days after written order, the Owner may withhold further payment by written notice until compliance with such order. 7.4 If, in the opinion of the Designer or the Owner, any Subcontractor on the Project is incompetent or otherwise unsatisfactory, he shall be replaced by the Contractor with no increase in the Contract Price if and when directed by the Designer or the Owner in writing. 7.5 The Contractor shall furnish all materials, equipment, labor, transportation, construction equipment and machinery, tools appliances, fuel, light, heat, and all other facilities and incidentals necessary for the execution, maintenance, initial operation, and completion of the Work, other than those specifically excluded by the Contract Documents and to be furnished by the Owner or others. When use or storage of hazardous materials or equipment or methods of more than ordinary risk are necessary in accomplishing the Work, the Contractor shall give the Owner and Designer reasonable advance notice. If any materials are to be furnished or installed by the Owner or others under the terms of the Contract Documents, said materials shall be made available to the Contractor at the location(s) specified in the Contract Documents. All costs of handling, transportation from the specified location to the Project, storage, and installing of Owner-furnished materials shall be included in the Contract Price. The Contractor shall be responsible for any demurrage, damage, loss, or other deficiencies which may occur during the Contractor's handling, storage, or use of such Owner-furnished material. The Owner shall deduct from any monies due or to become due the Contractor any cost incurred by the Owner in making good any such damage, loss, or efficiency. All equipment which is proposed to be used in the Work shall be of sufficient size and in such mechanical condition as to meet the requirements of the Work and produce a satisfactory quality of work. Equipment used on any portion of the Work shall be such that no injury to previously completed Work, adjacent property, or existing facilities shall result from its use. When the methods and equipment to be used by the Contractor accomplishing the Work are not prescribed in the Contract Documents, the Contractor shall be free to use any methods or equipment that will accomplish the Work in conformity with the requirements of the Contract Documents. When the Contract Documents specify the use of certain methods and equipment, such methods and equipment shall be used unless others are authorized by the Designer. If the Contractor desires to use a method or type of equipment other than specified in the Contract Documents, the Contractor may request authority from the Designer to do so. The request shall be in writing and shall include a full description of the methods and equipment proposed and of the reasons for desiring to make the change. If approval is given, it shall be on the condition that the Contractor shall be fully responsible for producing Work in conformity with the requirements of the Contract Documents. If, after trial use of the substituted methods or equipment, the Designer determines that the Work produced does not meet the requirements of the Contract Documents, the Contractor shall discontinue the use of the substitute method or equipment and shall complete the remaining Work with the specified methods and equipment at no additional cost to the Owner. The Contractor shall remove any deficient Work and replace it with Work of DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 20 Revised 12/18 specified quality, or take such other corrective action as the Designer may direct. No change in the Contract Price or in Contract Time shall be made as a result of authorizing a change in methods or equipment under this paragraph. 7.6 All materials and equipment shall be new, except as otherwise provided in the Contract Documents. When special makes or grades of material which are normally packaged by the supplier or manufacturer are specified or approved, such materials shall be delivered to the Project site in their original packages or containers with seals unbroken and labels intact. Materials shall be so stored as to assure the preservation of their quantity, quality and fitness for the Work. Stored materials, even though approved before storage, may again be inspected by the Designer or Owner prior to their use in the Work and shall meet the requirements of the Contract Documents at the time they are incorporated into the Work. Stored materials shall be located so as to facilitate their prompt inspection. The Contractor shall coordinate the storage of all materials with the Designer and the Owner. Materials to be stored at the Project or on the Owner's property shall not create an obstruction to the Owner's or other contractor's reasonable activities. Private property shall not be used for storage purposes without written permission of the owner or lessee of such property. The Contractor shall make all arrangements and bear all expenses for the storage of materials on private property. Upon request, the Contractor shall furnish the Owner a copy of the property owner's permission. All storage sites on private or the Owner's property shall be restored to their original condition by the Contractor at his entire expense, except as otherwise agreed to (in writing) by the owner or lessee of the property. 7.7 All materials and equipment shall be applied, installed, connected, erected, used, cleaned and conditioned in accordance with the instructions of the applicable manufacturer, fabricator, or processor, except as otherwise provided in the Contract Documents. 7.8 The Contractor will be fully responsible for all acts and omissions of his Subcontractors and of persons directly or indirectly employed by them and of persons for whose acts any of them may be liable to the same extent that the Contractor is responsible for the acts and omissions of the Contractor’s own employees. Nothing in the Contract Documents shall create any contractual relationship between any Subcontractor or supplier and the Owner or the Designer, or any obligation on the part of the Owner or the Designer to pay or see to the payment of any money due any such Subcontractor or material furnisher except as may otherwise be required by law. The Owner or the Designer may furnish to any Subcontractor or supplier, to the extent practicable, evidence of amounts paid to the Contractor on account of specific Work done. 7.9 The divisions and sections of the Specifications and the identifications of any Drawings shall not control the Contractor in dividing the Work among Subcontractors. 7.10 The Contractor agrees to bind specifically every Subcontractor to the terms and conditions of the Contract Documents for the benefit of the Owner and to furnish written evidence thereof to the Designer and the Owner within seven (7) days after written request by the Owner. 7.11 The Contractor shall attend job progress conferences and all other meetings or conferences as directed by the Designer. The Contractor shall be represented at these job progress conferences by a representative having the authority of the Project Manager and by such other representatives as the Designer may direct. Job progress conferences shall be open to Subcontractors, suppliers and any others who may contribute beneficially toward maintaining DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 21 Revised 12/18 required job progress, and such personnel shall be encouraged by the Contractor to attend. It shall be the principal purpose of job progress conferences to effect coordination, cooperation and assistance in every practical way toward the end of maintaining progress of the Project on schedule and to complete the Work and the Project by the specified Completion Dates. The Contractor shall be prepared to assess progress of the Work as required in the Contract Documents and to recommend remedial measures for correction of progress as may be appropriate. The Designer shall preside as chairman and arrange for minutes to be taken and circulated. In the event that the prosecution of the Work is discontinued for any reason, the Contractor shall notify the Designer and the Owner at least forty-eight (48) hours in advance of resuming operations. Should the terms of the Contract Documents require completion of one or more portions of the Work for the Beneficial Occupancy of the Owner prior to completion of the entire Work, the Contractor shall complete such portion(s) of the Work on or before the date specified. Such completion shall include the obtaining of all government or other permits, permission, and/or approvals necessary to occupancy. The Contractor shall independently estimate the difficulties involved in arranging the Work to permit such Beneficial Occupancy and shall not claim any additional compensation or time extension by reason of any delay or increased cost due to completing such portion(s) of the Work. The Owner's possession and use of such portion(s) of the Work shall not be deemed an acceptance of any Work not completed in accordance with the Contract Documents. The Owner shall be responsible for the security, maintenance, utilities, and insurance of all portions of the Work completed and beneficially occupied by the Owner. 7.12 The Contractor shall pay all license fees and royalties, and assume all costs incident to the use of any invention, design process, or device which is the subject of patent rights or copyrights held by others, except for inventions, design processes, or devices specified by the Designer in the Contract Documents. The Contractor shall indemnify and hold harmless the Owner, the Designer, and anyone directly employed by either of them, from and against all claims, damages, losses and expenses, including attorney's fees and costs of defense, arising out of any infringement or alleged infringement of such rights during or after completion of the Work, and shall defend all such claims in connection with any actual or alleged infringement of such rights. 7.13 The Contractor shall secure and pay for all permits, including without limitation construction permits and licenses, and will pay all governmental charges and inspection fees necessary for the prosecution of the Work. 7.14 The Contractor shall give all notices and comply with all laws, ordinances, rules, and regulations applicable to the Work and shall protect and indemnify the Owner and the Owner’s officers, agents, or servants against any claim or liability arising from or based on the violation of any such law, ordinance, regulation, order, or decree, whether by the Contractor or by the Contractor’s employees, Subcontractors, sub-subcontractors, or their employees. 7.15 The Contractor shall be responsible for the entire site of the Project (except those under the Beneficial Occupancy of the Owner) and for its reasonable and necessary protection and security, as required by laws or ordinances governing such conditions, or by custom or sound construction practices, and shall share such responsibilities as may be agreed upon among DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 22 Revised 12/18 them, or in the absence of such agreement, as may be directed by the Contract Documents, Owner, or Designer. The Contractor shall be responsible for any damage to the Owner's property, or that of others, by the Contractor or the Contractor’s employees, Subcontractors, sub-subcontractors, or their employees or agents, and shall make good such damages. The Contractor shall be responsible for and pay for any such claims against the Owner. 7.16 The Contractor shall protect all landscaping designated to remain in the vicinity of the operations and barricade all walks, roads, and areas as necessary to keep the public away from the construction. 7.17 The Contractor shall provide cover and/or protect all portions of the Work and provide all materials necessary to protect the Work whether performed by the Contractor or any of the Subcontractors or sub-subcontractors. Any Work damaged through the lack of proper protection, or from any other cause, shall be repaired or replaced without extra cost to the Owner or extension to the Contract Time. The Contractor shall maintain the Work during construction and until the Work is accepted. This maintenance shall constitute continuous and effective effort prosecuted day by day, with adequate equipment and forces so that the Work is maintained in satisfactory condition at all times. All costs of maintenance shall be included in the Contract Price and the Contractor will not be paid an additional amount for such effort. Should the Owner or Designer observe that the Contractor at any time has failed to maintain the Work as provided herein, the Designer may immediately notify the Contractor of such noncompliance. Such notification shall specify a reasonable time within which the Contractor shall be required to remedy such unsatisfactory maintenance condition. Should the Contractor fail to properly respond to the Designer's notification, the Owner may, at the Contractor's expense, take such action as it may deem appropriate to remedy the defective maintenance, including suspension of the Contractor's Work or any part thereof. Any such expense incurred by the Owner shall be deducted from monies due or to become due the Contractor. Parking lots, streets, and walks connecting to the Project area shall be protected by the Contractor from deposits of mud, sand, stone, litter, or debris in any form. Pedestrian traffic areas around the construction limits must be maintained in a clean and safe condition at all times with required barricades and covered walkways. When excavation or other operations outside the Project limits is required, the Contractor shall, immediately following that work, return the area to its original condition. All catch basins and storm drain lines in the vicinity of the Project site shall be protected at all times from entry of dirt, rubble and other debris. The residue from the cleaning of trucks, wheelbarrows, concrete buggies, etc. must be prevented from entering the drainage system, and if cleaning is done, the residue must be contained and removed from the Project site with other refuse. 7.18 No burning of refuse or debris shall be allowed inside or around the Project during the course of construction without written authority from authorities having jurisdiction and the Owner. 7.19 The Contractor shall provide for and maintain necessary safety measures and safety programs for the protection of all persons involved with the Work. Such measures and programs DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 23 Revised 12/18 shall include the requirements of the most current edition of the CAGC Safety and Health Manual [or the AGC Accident Prevention Manual in Construction], or equivalent requirements, and shall fully comply with all Federal, State, and local laws, rules, regulations, and building code requirements relating to the prevention of accidents or injuries to persons on or about the location of the Work. All trenches, excavations, or other hazards in the vicinity of the Work shall be well barricaded, and properly lighted at night. When Work requires closing of an area normally used by the Owner or the public, the Contractor shall furnish, erect, and maintain temporary barricades, and properly light the area. The Contractor shall comply with any directions and public authorities in this respect. 7.20 The Contractor shall designate a responsible officer or employee as safety inspector, whose duties shall include accident prevention on the Project as well as implementation of the Contractor’s safety measures and safety programs on the Project. The name of the safety inspector shall be made known to the Designer and the Owner at the preconstruction conference. 7.21 In emergencies affecting the safety of persons, the Work, or property at the Project site or adjacent thereto, the Contractor is obligated to act in the Contractor’s discretion to prevent threatened damage, injury, or loss. As soon as practicable, the Contractor shall notify the Designer and Owner of such emergency. The Contractor shall give the Designer and the Owner prompt written notice of any significant changes in the Work or deviations from the Contract Documents caused by such emergency. If the Contractor believes that additional work done in an emergency entitles the Contractor to an increase in the Contract Price or an extension of the Contract Time, the Contractor may make a claim therefore as provided in Articles 14 and/or 15. 7.22 The Contractor shall at all times keep the premises free from accumulation of waste materials or rubbish caused by the Work. At least weekly and at the completion of the Work, the Contractor shall remove all waste materials and rubbish from and about the Project. At the completion of the Work, the Contractor shall remove all tools, construction equipment, machinery, and surplus materials. The Contractor shall leave the Work in condition for occupancy by the Owner such that no cleaning or other operations are required. Material cleared from the Project and deposited on adjacent property shall not be considered as having been disposed of satisfactorily. If the Contractor fails to keep the Project clean of waste materials or rubbish, fails to satisfactorily clean-up weekly or at the completion of the Work, the Owner may do so and the costs thereof may be deducted from any amounts due the Contractor. 7.23 Utilities, temporary facilities, and signs shall be provided as described in the Contract Documents. Absent a contrary direction in the Supplementary Conditions, the Contractor shall pay all bills for water, electricity, or other public utility service to the Project site. 7.24 The Contractor shall indemnify and hold the Owner, the Designer, the Designer's consultants, and their officers, agents, and employees harmless against all costs, damages, and expenses, including attorney's fees and costs of defense, arising out of claims by any separate contractor or by any Subcontractor, sub-subcontractor, or supplier engaged by or employed by the Contractor or employed by any of the Subcontractors claiming through him, including without limitation damages, losses, and expenses arising out of or relating to any DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 24 Revised 12/18 inconvenience, delay, interference, or other action or non-action of the Contractor or the Contractor’s Subcontractors on the Project. The Contractor acknowledges that should the Contractor or any of the Contractor’s Subcontractors be damaged by any breach of contract by any other separate prime contractor on the Project, the Contractor may invoke applicable dispute resolution procedures with said other separate prime contractor or bring a direct civil action against said other separate prime contractor. The Contractor hereby expressly agrees that neither the Owner nor its officers, agents, or employees shall have any liability of any kind or nature whatsoever to the Contractor, its Subcontractors, sub-subcontractors, or suppliers arising out of or relating to any breach, inconvenience, delay, interference, or other action or non-action by any other separate prime contractor. The Contractor covenants not to sue the Owner for any loss or damage caused by any breach, inconvenience, delay, interference, or other action or non-action by any other separate prime contractor, notwithstanding whatever rights at law the Contractor might have to bring a civil action against the Owner for any breach, inconvenience, delay, interference, or other action or non-action of any other separate prime contractor. The Contractor agrees to look exclusively to the other prime contractor for relief or remedy. Nothing contained herein or appearing anywhere in the Contract Documents shall obligate or require the Owner to exercise any right or privilege, or to take any action or to refrain from taking any action under any contract it may have with any other prime contractor or party to the Project for the benefit of the Contractor or any Subcontractor, subSubcontractor, or supplier claiming through the Contractor. 7.25 Prior to completion of the Work and Final Payment of the Contract Price, excepting only those portions of the Work deemed accepted in accordance with the Contract Documents, the Contractor shall have charge and care of the Work, and shall take every precaution against injury or damage to any part due to the action of the elements or from any other cause, whether arising from the execution or from the non-execution of the Work. The Contractor shall as required by the Owner replace, rebuild, repair, restore, and make good all injury or damage to any portion of the Work occasioned by any of the above causes before Final Completion and shall bear the expenses thereof. 7.26 In the event that the Work, or any portion thereof, is suspended at any time pursuant to an order of the Owner, the Contractor shall obey all instructions of the Owner regarding storage of materials, drainage, protection of the Work, and erection of temporary structures during the suspension period. 7.27 The Project Expediter for the Project shall be responsible for the coordination of the Work of itself and any other separate contractors, both as to space and time. The Project Expediter shall coordinate the implementation of the Contract Construction Schedule, all construction activities and close-out of the Project, including but not limited to all testing, inspection, certifications, and approvals required by public agencies. The Contractor and the Project Expediter shall each be required to notify the Designer and the Owner promptly of any event or condition which could affect the conduct or progress of the Work and shall cooperate fully with all other contractors on the Project site. 7.28 The Owner hereby delegates to the Project Expediter all of its duties to coordinate and to DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 25 Revised 12/18 expedite the Work not expressly reserved to the Owner by other provisions of the Contract Documents. 7.29 All Work performed pursuant to the Contract Documents shall conform in all respects to the North Carolina State Building Code and all other state, local, and national codes in effect at the time of and applicable to this Work. 7.30 The Contractor shall provide for and maintain necessary safety measures and safety programs for the protection of all persons at the Project site, and shall comply at all times with the requirements of the most current edition of the CAGC Safety and Health Manual [or the AGC Accident Prevention Manual in Construction], or the equivalent requirements of the Contractor’s safety program, and shall fully comply with all Federal, State, and local laws, rules, regulations, and building code requirements so as to prevent accidents or injuries to persons on or about the Project site. The Contractor shall clearly mark or post signs warning of existing hazards, and shall barricade excavations, elevator shafts, stairways, and similar hazards. The Contractor shall protect against damage or injury resulting from falling materials, and shall maintain all protective devices and signs throughout the progress of the Work. 7.31 The Contractor shall adhere to the rules, regulations, and interpretations of the North Carolina Department of Labor’s Occupational Safety and Health Standards for the Construction Industry (29 CFR Part 1926 as adopted in 13 NCAC 07F.0201, including 29 CFR Part 1910 General Industry Safety and Health Standards applicable to construction) and N.C. Gen. Stat. §95-126 through 155 (Occupational Safety and Health) as well as all revisions and amendments to such standards or statutes as may occur throughout the performance of the Work. 7.32 Any land disturbing activity performed by the Contractor in connection with the Project shall comply with all erosion control measures set forth in the Contract Documents and any additional measures which may be required in order to ensure that the Project is in full compliance with the Sedimentation Pollution Control Act of 1973, as implemented by Title 15 North Carolina administrative Code, Chapter 4, Sedimentation Control, Subchapters 4A, 4B and 4C, as amended (15 NCAC 4A, 4B, and 4C), and as may be revised or amended in the future. Upon receipt of notice that a land-disturbing activity is in violation of said Act, the Contractor shall be responsible for ensuring that all steps or actions necessary to bring the Project in compliance with said Act are promptly taken. The Contractor shall be responsible for all penalties assessed pursuant to N.C. Gen. Stat. 113A-64 with respect to its Work, and shall indemnify and hold harmless the Owner from all costs and expenses, including attorney's fees and costs of defense arising out of or related to the enforcement of the Act against any party or person described in this Article. 7.33 Any mechanical or electrical work such as sleeves, inserts, chases, etc. located in the Work of the Contractor for general work shall be built in by that Contractor. On multiple prime projects, the mechanical and electrical contractors shall set all sleeves, inserts, and other devices built into the structure in cooperation and under the supervision of the Contractor for general work. The responsibility for exact location of such items shall be that of the mechanical, plumbing, or electrical prime contractor. 7.34 The Contractor shall be responsible for permanently fixed service facilities and systems in use during progress of the Work and shall strictly adhere to the following procedures: DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 26 Revised 12/18 a) Prior to acceptance of the Work by the Owner, the Contractor shall remove and replace any part of the permanent building systems damaged through use during construction. b) Temporary filters shall be installed in each of the heating and air conditioning units, return air grilles, and other locations to prevent intrusion of dust, dirt, and debris during construction. Temporary filters shall be removed and replaced with new filters immediately prior to Substantial Completion. c) Extra effort shall be maintained to keep the building clean and under no circumstances shall air systems be operated if finishing operations are creating dust in excess of what would be considered normal if the building were occupied. d) When the permanent lighting system is used during construction, lamps shall be replaced and shall be new on the date of Substantial Completion. ARTICLE 8. OWNER 8.1 The Owner shall issue communications and notices to the Contractor through the Designer to the extent contemplated by the Contract Documents. 8.2 In case of termination of the employment of the Designer, the Owner shall appoint as Designer a qualified person who shall have and assume all rights and duties held by the original Designer. 8.3 The Owner shall have the right to take possession of and use any portion of the Work notwithstanding the fact that the time for completion of such portion of the Work may not have expired, but such taking possession and use shall not be deemed an acceptance of any Work not completed in accordance with the Contract Documents. 8.4 A waiver on the part of the Owner of any breach of any part of the Contractor shall not be held to be a waiver of any other or subsequent breach. 8.5 The Owner shall pay all permanent acreage fees, governmental impact fees, and meter deposits for permanent utilities. ARTICLE 9. CONSTRUCTION MANAGER 9.1 The Owner may employ one or more Construction Managers for the purpose of assisting the Owner, Designer, and Contractor in developing and administering budgets and cost controls, in evaluating constructability and value engineering proposals, in establishing and maintaining a critical path method (CPM) schedule, in coordinating and/or expediting the Work with other projects being constructed by the Owner or others adjacent or near the Work, or for such other purposes as the Owner may deem appropriate. From time to time the Owner may identify such Construction Managers(s) to the Contractor in writing identifying any tasks assigned to such Construction Managers(s). ARTICLE 10. DESIGNER DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 27 Revised 12/18 10.1 The Designer is charged with the responsibility of interpretation of the Contract Documents. The Designer’s decisions relating to aesthetic matters shall be final. 10.2 All Work completed under the Contract Documents shall be subject to review by the Designer. No Work is to be covered without the Designer's review or prior authorization. Any Work so covered without the Designer's review or prior authorization shall be uncovered at the Contractor's expense. The Contractor shall notify the Designer in writing at least twenty-four (24) hours in advance of covering any Work. 10.3 The Designer shall not be responsible for the construction means, methods, techniques, sequences, procedures, or the safety precautions and programs incident thereto, and shall not be responsible for the Contractor's failure to perform the Work in accordance with the Contract Documents, but shall be entitled to enforce any requirements in the Contract Documents specifying particular means, methods, techniques, sequences, or procedures. 10.4 The Designer shall be an Owner's representative during the construction period. The duties, responsibilities and authority of the Designer as the Owner's representative during construction are as set forth in the Contract Documents. ARTICLE 11. TESTING AND SURVEYING 11.1 Laboratory and field tests to determine compliance of construction with the Contract Documents shall be made by the Owner or testing consultants employed by the Owner except those required elsewhere in the Contract Documents to be paid for by the Contractor. The costs and expenses of providing samples for and assistance in any testing shall be borne by the Contractor and are included in the Contract Price. Any Work in which untested materials are used without approval or written permission of the Designer shall be removed and replaced at the Contractor's expense. Work found to be unacceptable or unauthorized will not be paid for and, if directed by the Designer shall be removed and replaced at the Contractor's expense. Unless otherwise designated, tests in accordance with the cited standard methods of ASTM or other generally recognized or specifically authorized methods which are current on the date of advertisement for bids shall be made at the expense of the Owner; provided, however, in the event that after such testing any Work is found to be defective or does not meet the requirements of the Contract Documents, the costs of retesting such Work and the costs of inspection services shall be paid by the Contractor. Samples shall be taken by a testing laboratory employed by the Owner. All materials being used are subject to inspection, tests, or rejection at any time prior to or during incorporation into the Work. Copies of all Owner test reports will be furnished to the Contractor at his written request. Copies of Contractor test reports shall be furnished to the Designer upon written request. 11.2 The Owner shall have the right to deduct the costs of additional testing as described in paragraph 11.1 from any money due the Contractor; or if no money is due the Contractor, the Owner shall have the right to recover these costs from the Contractor, from its sureties, or from both. 11.3 All layouts and surveying shall be accomplished by properly qualified personnel duly licensed in the State of North Carolina. ARTICLE 12. SEPARATE CONTRACTS DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 28 Revised 12/18 12.1 It is expressly understood that the Owner may deploy the Owner’s own employees or engage other separate prime contractors to perform Work as a part of the Project whose work will be performed simultaneously and sequentially with the performance of the Work by the Contractor. It shall be necessary for the Contractor to coordinate construction activities with such other contractors, particularly with respect to access to work areas, storage of materials, and use of elevators and other common facilities. The Contractor shall diligently and in good faith cooperate with the Owner, the Designer, and all other contractors with respect to such matters and shall regularly and faithfully attend any and all meetings called by the Owner or the Designer with respect to such matters. Any disputes between the Contractor and any other separate prime contractor with respect to such matters shall be resolved in accordance with the claim and dispute resolution procedures in the Agreement. ARTICLE 13. CONTRACT TIME 13.1 Within fourteen (14) days after receipt of the Construction Contract by the Contractor for signatures, the Project Expediter shall prepare and submit to the Designer and Owner for review and approval a preliminary progress schedule for the Work pursuant to the requirements stated in the Contract Documents. 13.2 Within fourteen (14) days after initial receipt of the Construction Contract for signatures the Contractor shall submit to the Designer a Submittal Register listing all Submittals the Contractor is required to make or proposes to make under the Contract Documents, the dates on which the Contractor proposes to make such Submittals and the dates by which the Contractor reasonably requires a response from the Designer with respect to each Submittal. The dates submitted shall be incorporated into the Contract Construction Schedule as Completion Dates when they have been approved or modified by the Owner. The Designer shall not be required to review any Submittal from the Contractor until a Submittal Register acceptable to and approved by the Owner has been submitted by the Contractor. 13.3 Not later than thirty (30) days following execution and delivery of the Construction Agreement by Owner to Contractor, the Owner shall deliver to the Contractor a Notice to Proceed. The Notice to Proceed shall state a commencement date on which it is expected that the Contractor will begin the Work to be performed under the Agreement. The Contract Time shall be measured from said specified commencement date. The commencement date stated in the Notice to Proceed shall not be earlier than three (3) days after the Notice to Proceed is served on the Contractor. If, other than by mutual agreement, said specified commencement date is more than thirty (30) days after the date of execution and delivery of the Agreement from Owner to Contractor and the Contractor believes said delay justifies an increase in Contract Price and/or an extension of Contract Time, the Contractor may make a claim therefore as provided in Article 14 and/or Article 15. No Work shall be done prior to the date specified in the Notice to Proceed. A final Contract Construction Schedule shall be submitted for approval by the Contractor, Designer, and Owner no later than fourteen (14) days after Notice to Proceed. No payments shall be due the Contractor until this schedule is approved by all parties. 13.4 The Contract Construction Schedule is a Contract Document. The Contractor represents that the Contract Construction Schedule has been reviewed in detail, that the Contractor DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 29 Revised 12/18 participated in its preparation, that all of the activities which impact, limit, or otherwise affect the time of completion of the Work are shown in the Contract Construction Schedule and that all of the activities of others which impact, limit, or otherwise affect the start, duration, or completion of the Contractor’s activities are also shown. The Contractor further represents that the Contractor can and will complete each activity within the time shown for that activity. Time is of the essence with respect to each such activity and Completion Date. 13.5 If the Contractor submits a construction schedule, progress report, or any other document that indicates or otherwise expresses an intention to achieve completion of the Work prior to any Completion Date required by the Contract Documents or prior to expiration of the Contract Time, no liability of the Owner to the Contractor for any failure of the Contractor to so complete the Work shall be created or implied. 13.6 If the Contractor, for reasons beyond the Contractor’s control, is delayed in beginning any activity, the Contractor shall, nevertheless, have the same number of days as is shown in the Contract Construction Schedule for the activity, and the affected activity and any succeeding activity that is dependent upon that activity shall be adjusted accordingly; provided that at any time the Owner, by means of a Change Order, may require the Contractor to work overtime, to increase labor forces or to take any necessary or appropriate action to decrease the time required for any activity, and the Contractor shall be entitled to an adjustment in the Contract Price computed in accordance with Article 15 of these General Conditions. 13.7 At any time, the Owner may order the Contractor, on seven (7) days written notice, to begin any activity earlier than the starting date shown on the Contract Construction Schedule. 13.8 Should the Contractor fail to start any activity on the start date shown in the Contract Construction Schedule or as it may have been adjusted in accordance with paragraphs 13.5 or 13.6 above, or become delayed, the Contractor shall, without being entitled to any increase in the Contract Price or other compensation, work overtime, increase labor forces or take such other action as may be necessary or appropriate to complete the activity by the Completion Date shown on the Contract Construction Schedule, or as such Completion Date may have been adjusted. 13.9 The Designer and Owner or his Construction Consultant shall monitor progress of the work at all times and the Contractor shall cooperate with such monitoring and provide any and all information with respect to the progress of the Work and scheduling as the Owner may reasonably require. 13.10 On a monthly basis, the Contractor shall revise the Contract Construction Schedule, showing any adjustments made in accordance with paragraphs 13.5 or 13.6, above, by any Change Order, the progress of the Work, and any days gained or days lost with respect to any activity, and shall furnish copies thereof to the Owner and Designer. 13.11 Should any monthly revision of any Contract Construction Schedule show that the Contractor is behind on any activity, the late completion of which could delay Substantial Completion of the Work, the Owner shall be entitled to withhold from the next Progress Payment due the Contractor an amount not exceeding the amount the Owner would be entitled to in Liquidated Damages, should Substantial Completion be delayed by the same number of days that the Contractor is currently behind schedule. If, subsequently, the Contractor's progress, as DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 30 Revised 12/18 shown by any succeeding monthly revision to the Contract Construction Schedule, is such that the anticipated delay no longer exists, the Owner shall pay with the Progress Payment next due to the Contractor such amounts as have been withheld in accordance with this paragraph. 13.12 The Owner shall have the right to perform Work, hire and employ labor and craftsmen, rent equipment, subcontract with other parties, or do anything that the Owner deems necessary or appropriate to remedy or cure any delay by the Contractor in the progress of the Work. Such action by the Owner shall not, in any way, affect, void or limit any warranty, guaranty or other responsibility of the Contractor under the Contract Documents. Such action may be taken by the Owner only after three (3) days written notice to the Contractor. All costs incurred by the Owner in taking any such action shall be charged to the Contractor and deducted from any amounts remaining due under the Agreement. 13.13 The Contractor may be entitled to an extension of the Contract Time (but no increase in the Contract Sum) for delays arising from unforeseen causes beyond the control and without the fault or negligence of the Owner, the Contractor or the Contractor’s Subcontractors as follows: a) Labor disputes and strikes that directly impact the critical path activities of the Contract Construction Schedule; b) Acts of God, tornado, fire, hurricane, blizzard, earthquake, typhoon, or flood that damage completed Work or stored materials. c) Acts of the public enemy; acts of the State, Federal, or local government in their sovereign capacities. d) Abnormal inclement weather as defined in Article 13.14. 13.14 On any day that the Contractor considers that the Project is delayed by adverse weather conditions, the Contractor shall identify in writing to the Designer and the Owner the adverse weather conditions affecting each activity, the specific nature of the activity affected, the number of hours lost, and the number of and identity (by responsibility or trade) of workers affected and shall obtain from the Designer written recognition of the delay. The time for performance of this Contract includes an allowance for a number of calendar days which may not be suitable for construction Work by reason of adverse weather. The Contract Time will be extended only if the number of calendar days of adverse weather recognized by the Designer exceeds the number of inclement weather days set forth below, and the Contractor demonstrates how this adverse weather impacts activities on the critical path of the Contract Construction Schedule. Month Number of Inclement Weather Days January 10 February 10 March 10 April 9 May 10 June 9 July 11 August 10 September 8 October 7 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 31 Revised 12/18 November 8 December 9 13.15 If the Contractor believes that the progress of the Work has been adversely affected by adverse weather recognized by the Designer during a particular month, the Contractor shall submit a written request for extension of time to the Designer. Such a request for time extension of the Contract Time shall be submitted by the tenth (10th) day of the month following that month in which the adverse weather is encountered. The request shall include, but is not limited to, the following information: a) Detailed description of weather's effect on scheduled activities and its net effect on the critical path of the Project, and b) Weather records from the official weather station nearest the Project site and records of actual observation as contained in daily reports, correspondence, or other documentation. 13.16 The Contractor specifically recognizes that a delay by the Contractor in achieving any Completion Date can have the effect of delaying the Substantial Completion of the Project, that such delay in Substantial Completion of the Project will necessarily cause damages, losses, and expenses to the Owner, including, but not limited to and by way of illustration only, increased capitalized costs and interests for the Project, increased and extended Project overhead, Designer's and Consultant's fees, increased costs of construction, increased and extended operation costs of other facilities, and inefficiency and loss of productivity, and that such damages, losses, and expenses may not be readily identifiable or ascertainable at the time they are incurred or at any time. Therefore, and in recognition of these factors and the likelihood that actual damages from his delay will not be readily ascertainable, the Contractor agrees to pay to the Owner, as Liquidated Damages and not as a penalty, the sum identified in the Contract Documents hereto as the Liquidated Damages per Day, for each day by which the failure to meet any Completion Date shown in the Contract Construction Schedule, adjusted in accordance with this Article, delays the Substantial Completion of the Project. 13.17 The Contractor shall not be entitled to any adjustment in the Contract Price or other compensation from the Owner for any delay in the completion of or progress on the Work that is caused by a force majeure condition or is otherwise not caused by the sole and direct act or omission of the Owner and the Owner’s employees or agents. 13.18 The sum for Liquidated Damages is the amount stated in the Contract Documents as Liquidated Damages reasonably estimated in advance to cover the losses to be incurred by the Owner by reason of failure of said Contractor(s) to complete the Work within the time specified, such time being in the essence of this contract and a material consideration thereof. ARTICLE 14. CHANGES IN THE WORK 14.1 Without invalidating the Contract Documents, the Owner may, at any time, or from time to time order additions, deletions, or revisions in the Work. Said additions, deletions, or revisions shall be authorized only by written Change Orders, Construction Change Directives or Field Orders. Upon receipt of a Change Order, Construction Change Directive or Field Order, the Contractor shall proceed with the Work involved. All such Work shall be executed under the applicable conditions of the Contract Documents. If any change causes an increase or decrease in the Contract Price and/or an extension or shortening of the Contract Time, adjustments shall be made as provided in Article 14 and/or Article 15. In order to expedite the Work and avoid or minimize delay in the Work that might affect the Contract Price or Contract Time, the Designer DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 32 Revised 12/18 may issue a Change Order in the form of a Construction Change Directive which when signed by the Owner and Designer, directs the Contractor to proceed promptly with the Work involved. Any claim for an adjustment in Contract Price or Time, if not defined in the Construction Change Directive, shall be promptly made in writing in accordance with the procedures defined in Article 15.2. 14.2 The Designer may authorize minor changes or alterations in the Work not involving change in the Contract Price or in the Contract Time and not inconsistent with the overall intent of the Contract Documents. These may be accomplished by a Field Order. Such alterations shall not invalidate the Contract Documents nor release the surety. If the Contractor believes that any minor change or alteration authorized by the Designer entitles him to an increase in the Contract Price and/or an extension of Contract Time, he may make a claim therefore as provided in Article 14 and/or Article 15. 14.3 Except in an emergency endangering life or property, no change shall be made by the Contractor except upon prior written Change Order, Directive or Field Order authorizing such Change. 14.4 Increases in the Contract Price and/or extensions of the Contract Time for additional Work performed by the Contractor shall only be in accordance with a written Change Order signed by the Owner and Designer. The Contractor shall not be entitled to additional time or to additional compensation for any Work performed or material supplied which is claimed to have been authorized or settled by an "oral" change, or by a "constructive" or "implied" change, or by a course of conduct, or by any action or non-action by the Owner, Designer, or any other persons, or by any means whatsoever other than by a written Change Order for such Work or material signed by the Owner and the Designer. 14.5 Changes in the Work resulting from emergency shall not invalidate the Contract Documents nor release the surety. 14.6 Neither the Owner nor the Designer shall be responsible for verbal instructions which have not been confirmed in writing, and in no case shall such instructions be interpreted as permitting a departure from the Contract Documents unless such instruction is confirmed in writing and supported by a proper Change Order, Construction Change Directive or Field Order, whether or not the cost is affected. 14.7 The Owner, in its sole discretion, may require that the Contractor notify the Contractor’s sureties of any changes affecting the general scope of the Work or change in the Contract Price, and that the amount of applicable bonds shall be adjusted accordingly. If this requirement is exercised, the Contractor shall furnish proof of such adjustment to the Designer and the Owner. If this requirement is exercised, the Change Orders shall require written consent of the Contractor's surety. At the time of signing a Change Order, the Contractor shall be required to certify as follows: "I certify that all sureties have been notified that my contract has been altered by the amount of this Change Order, and that a copy of the approved Change Order will be mailed to all sureties upon its receipt by me." If this requirement is exercised, no payment to the Contractor on account of any Change Order shall become due or payable until written evidence DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 33 Revised 12/18 of the surety's consent to the Change Order has been furnished to the Designer and to the Owner, and the furnishing of such written consent is a condition precedent to such payment. 14.8 The Contractor shall support all requests for Change Orders with a detailed cost breakdown showing cost of materials, labor, equipment, transportation, other items, Contractor's overhead and profit, and total cost, in accordance with methods defined in this Article, and, if the request seeks an extension of the Contract Time, with a time-related diagram which demonstrates specifically why an increase in construction time is needed. 14.9 When a request for a Change Order involves a Subcontractor, the Contractor shall provide quotation from same on Subcontractor's letterhead. The Subcontractor's quote shall list materials, equipment, and labor separately, and show overhead and profit in the manner provided in paragraph 14.8. ARTICLE 15. CHANGE OF THE CONTRACT PRICE 15.1 The Contract Price constitutes the total compensation payable to the Contractor for performing all Work under the Contract Documents. All duties, responsibilities, and obligations assigned to or undertaken by the Contractor shall be at his expense without change in the Contract Price. The Contract Price may only be changed by a Change Order. 15.2 Any claim for an adjustment in the Contract Price shall be in writing and written notice of any event, action, or non-action which may become the basis of a claim shall be delivered to the Owner and the Designer within three (3) days of the occurrence of any such event, action or non-action giving rise to the claim. Such written notice is a condition precedent to the making of a claim, and such notice shall describe the basis of the potential claim with reasonable detail and clarity. A claim shall be made in writing and shall be delivered to the Designer and the Owner no later than fourteen (14) days after such notice. The claim shall describe in detail the basis for the claim, with specific reference to any provisions of the Contract Documents, by paragraph, drawing number, or other specific identification, and shall state the amount claimed and how it is calculated. If the Contractor, at the time the claim is made, is unable to state the amount claimed with accuracy, the Contractor shall so state and provide the estimated amount and the basis on which the amount is to be calculated. At the earliest date practicable, but in no event more than thirty (30) days after Contractor's notice of claim, the Contractor shall supplement the claim with an accurate statement of the amount claimed and how it has been calculated. The Contractor shall provide, in writing, in support of the claim all such explanations, arguments, data, receipts, expert opinions, or other documents or information as the Contractor deems appropriate to be considered in support of the claim. A claim may properly be rejected by the Owner by reason of the Contractor's failure to submit adequate or accurate documentation or information, except that within seven (7) days after being given notice that the claim has been rejected on this basis, the Contractor may submit additional documentation or information. No claim for a change of the Contract Price shall be considered or granted (except solely at the discretion of the Owner) unless a claim is so made, nor shall the Contractor be entitled to any increase in the Contract Price unless the Contractor has given notice and made such a written claim within the times required. The Owner shall decide, after obtaining the advice of the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 34 Revised 12/18 Designer, whether an increase in Contract Price is warranted, and the amount of such increase shall be determined as provided in paragraph 15.4 through 15.5, below. Any change in the Contract Price resulting from any such claim shall be incorporated in a Change Order. The Owner shall advise the Contractor of its decision with respect to the claim within fourteen (14) days of its receipt, or of the receipt of additional documentation or information if the absence of such has previously been the basis of rejection of the claim; provided, however, that if, in its sole discretion, the Owner deems that review or consideration of any part of the claim or any matter related thereto by its governing Board is necessary or appropriate, it shall so advise the Contractor and shall provide its decision to the Contractor within seven (7) days after such Board consideration, review or action. Any claim on which the Owner has not provided its decision to the Contractor within the applicable time period shall be deemed denied. If the Contractor is not satisfied with the decision of the Owner, the Contractor may within seven (7) days of receipt of the Owner's decision initiate the mediation process as described in Appendix A to the General Conditions of the Contract for Construction. 15.3 In determining the amount of a Contract Price adjustment, the parties shall apply the following methods, as appropriate: (A) Change in Work: The Owner and Contractor shall negotiate in good faith and attempt to agree upon the value of any change (extra or decrease) in Work prior to the issuance of a Change Order covering said Work. Such Change Order shall set forth the corresponding adjustment to the Contract Price. In the event the Owner and the Contractor are unable to agree, the Owner shall grant an equitable adjustment in the Contract Price. (B) Emergency Work: In the event of emergency endangering life or property, the Contractor may be directed by the Designer to proceed on a time and material basis, whereupon the Contractor shall so proceed and keep accurately, in such form as may be required by the Designer, a correct account of costs together with all proper invoices, payrolls, and supporting data therefore. 15.4 Where the Contract Price is to be adjusted, the following limitations shall apply in determining the amount of adjustment: (A) In the case of extra or emergency work, the Contract Price shall not be increased by more than the reasonable, actual, and documented net cost of the extra or emergency work plus ten percent (10%) of such net cost on Work performed by the Contractor and five percent (5%) thereof on any subcontracted Work for overhead and profit combined. (B) In the case of a decrease in Work, the Contract Price shall not be decreased by less than the net cost of the deleted Work plus five percent (5%) of such direct net cost for profit and overhead. The term 'net cost' as used herein shall include, as applicable, and shall be limited to, all direct labor, direct material, direct equipment, labor burden, sales taxes, shipping and handling charges, permits and fees, and insurance and bond premium adjustments, if any, attributable to the change. All other items of cost shall be considered as overhead and covered by the percentages allowed in sections A and B of this paragraph. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 35 Revised 12/18 The Contractor shall provide worksheets or tabulations describing the method by which the direct net cost was calculated, and shall provide all data needed to support the calculation of the direct net cost, all in a form acceptable to the Owner. 15.5 Where the Contract Price is to be adjusted by negotiation, the Owner may authorize and designate the Designer to negotiate with the Contractor on behalf of the Owner; provided, however, any agreement reached between the Contractor and Designer shall be subject to approval by the Owner. ARTICLE 16. UNFORESEEN CONDITIONS 16.1 Should the Contractor encounter unforeseen conditions at the Project site materially differing from those shown on the Drawings or indicated in the Specifications or differing materially from those ordinarily encountered and generally recognized as inherent in work of the character provided for in this Agreement, the Contractor shall immediately, and in no event more than three days later, give notice to the Owner of such conditions before they are disturbed. The Owner and the Designer shall thereupon promptly investigate the conditions and if they find that they materially differ from those shown on the Drawings or indicated in the Specifications, they shall at once make such changes in the Drawings and/or Specifications as they may find necessary. Any increase or decrease in the Contract Price resulting from such changes shall be adjusted in the manner provided herein for adjustments as to extra and/or additional Work and changes. However, neither the Owner nor the Designer shall be liable or responsible for additional work, costs, or changes to the Work that could have been reasonably determined from any reports, surveys, and analyses made available for the Contractor's review or that could have been discovered by the Contractor through the performance of its obligations pursuant to the Contract Documents. ARTICLE 17. CORRECTION OF WORK BEFORE FINAL PAYMENT 17.1 The Owner has the authority to stop or suspend work, and the Designer has the authority to order Work removed or to order corrections of defective Work or Work not in compliance with the Contract Documents where such action may be necessary to ensure successful completion of the Work. Any work, materials, fabricated items, or other parts of the Work which have been found by the Designer to be defective or not in accordance with the Contract Documents shall be condemned and shall be removed from the Project by the Contractor, and immediately replaced by new Work in accordance with the Contract Documents at no additional cost to the Owner. Work or property of the Owner or others damaged or destroyed by virtue of such condemned Work shall be made good at the expense of the Contractor. Correction of condemned Work described above shall be commenced by the Contractor within twenty-four (24) hours after notice from the Designer or the Owner and shall be pursued to completion. Should the Contractor fail to proceed reasonably with the abovementioned corrections, the Owner may, three (3) days after the notice specified in the preceding sentence, proceed with correction, paying the cost, including costs of uncovering such condemned Work, of such corrections from amounts due or to become due to the Contractor. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 36 Revised 12/18 Condemned Work removed shall be the property of the Contractor and shall be removed from the Project by him within ten (10) days after notice to remove it, and if not then removed, thereafter may be disposed of by the Owner without compensation to the Contractor and the cost of such disposal shall be deducted from amounts due or to become due to the Contractor. Should the cost of correction of the Work and, if applicable, disposal of the condemned Work by the Owner exceed amounts due or to become due the Contractor, then the Contractor and the Contractor’s sureties shall be liable for and shall pay to the Owner the amount of such excess. ARTICLE 18. CORRECTION OF WORK AFTER SUBSTANTIAL COMPLETION; WARRANTIES AND GUARANTIES 18.1 Neither the final certificate, Final Payment, occupation of the premises by the Owner, nor any provision of the Contract Documents, nor any other act or instrument of the Owner or the Designer shall relieve the Contractor from responsibility for negligence, defective material or workmanship, or failure to comply with the Contract Documents. 18.2 The Contractor shall, at the Contractor’s sole cost and expense, make all necessary repairs, replacements, and corrections of any nature or description, interior or exterior, structural or non-structural, that shall become necessary by reason of defective workmanship or materials which appear within a period of one (1) year from the date of Substantial Completion; provided, however that notwithstanding the preceding, if any longer guarantee period is specified for any particular materials or workmanship under the Contract Documents, or under any subcontract, or in connection with any manufactured unit which is installed in the Project, or under the laws of the State of North Carolina, the longer guarantee period shall govern. 18.3 If, within any guarantee period, repairs or changes are required in connection with the Work, which are rendered necessary as the result of the use of materials, equipment, or workmanship which are inferior, defective, or not in accordance with the terms of the Contract Documents, the Contractor shall, promptly upon receipt of notice from the Designer and without expense to the Owner: a) Completely repair or replace the Work so that it conforms to the Contract Documents; b) Correct all defects therein; c) Make good all damage which, in the opinion of the Designer, is the result of the use of materials, equipment, or workmanship which are inferior, defective, or not in accordance with the terms of the Contract Documents; and d) Make good any Work or material, or any equipment or contents disturbed in fulfilling any such guarantee. If, in fulfilling the requirements of the Contract Documents or of any guarantee embraced therein or required thereby, the Contractor disturbs any work, facility, premises, or construction belonging to the Owner, the Contractor shall restore such disturbed work to a condition satisfactory to the Owner, and shall guarantee such restored work to the same extent as if it were Work under the Contract Documents. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 37 Revised 12/18 If the Contractor, after notice, fails to proceed promptly to comply with the terms of the guarantee, the Owner may have the defects corrected, and the Contractor and the Contractor’s ureties shall be liable for all expenses incurred. "Promptly" is defined as within twenty-four (24) hours for systems necessary to normal operation of the building and within seventy-two (72) hours for all other items. All special guarantees applicable to definite parts of the Work that may be shown in or required by Contract Documents shall be subject to the terms of this paragraph during the first year of the life of such special guarantee. Manufacturer's standard guarantees or warranties which do not comply with the time limit specified herein shall be extended by the Contractor automatically without further action on the part of the Owner or the Desig ner. 18.4 In the eleventh calendar month after the date of Substantial Completion, and at the request of the Owner, the Contractor, the Owner and the Designer shall make an inspection of the Work for the purpose of identifying defective workmanship and/or materials. If the Contractor, having been requested to do so by the Owner, fails to participate in such inspection, the Contractor shall be conclusively bound by any decision or ruling by the Designer as to any defective workmanship or material and as to the Contractor's responsibility for its repair or replacement. ARTICLE 19. OWNER'S RIGHT TO DO WORK 19.1 If, during the progress of the Work or during any period of guarantee, the Contractor fails to prosecute the Work properly or to perform any provision of the Contract Documents, the Owner, after three (3) days written notice to the Contractor from the Designer, or from the Owner after Final Payment, may perform or have performed that portion of the Work and may deduct the cost thereof from any amounts due or to become due the Contractor. Notwithstanding any action by the Owner under this paragraph, all warranties and bonds given or to be given by the Contractor shall remain in effect or shall be given by the Contractor. 19.2 Should the cost of such action by the Owner exceed the amount due or to become due the Contractor, the Contractor and his sureties shall be liable for and shall pay to the Owner the amount of such excess. ARTICLE 20. PARTIAL PAYMENTS 20.1 Within thirty (30) days after his initial receipt of the Construction Contract for signatures, the Contractor shall submit to the Designer a Schedule of Values. The Schedule of Values shall indicate the value of the Work, including applicable overhead and profit, for each Division and section of the Project Specifications. The Designer and Owner shall be provided with the Contractor's estimate papers, Subcontractor agreements, supplier quotes, or other documents substantiating these values if so requested in writing by the Designer. The Contractor shall provide the requested documentation within seven (7) days after receipt of the Designer's written request. The Schedule of Values shall be subject to approval by the Owner, and if the Owner and the Contractor cannot agree upon the Schedule of Values, the Designer shall prepare it, and the Schedule of Values as prepared by the Designer shall be binding on the Owner and the Contractor. No Request for Payment shall be certified by the Designer until the Designer has issued approval of said Schedule of Values. 20.2 Not later than the fifth (5th) day of each calendar month the Contractor shall submit to the Designer a Request for Payment for Work done during the previous calendar month. The DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 38 Revised 12/18 Request for Payment shall be in form of AIA Document G702 (latest edition) and shall show substantially the value of Work done (including the value of material delivered to the Project or stored by the Contractor at another site, subject to the conditions hereinafter set forth) during the previous calendar month, and shall sum up the financial status of the Work with the following information: a) Total Contract Price, including any adjustment thereto made pursuant to the Contract Documents. b) Value of Work completed and materials properly stored to date. c) Less amount retained. d) Less previous payments. e) Current amount due. f) Balance remaining. The Contractor, upon request of the Designer, shall substantiate the request with invoices, vouchers, payrolls, or other evidence. 20.3 When payment is requested or made on an account of stored materials, such materials must be stored on the Owner's property at such places and in such a manner as may be designated by the Designer. However, in the sole discretion of the Owner, with permission in writing from the Designer and Owner and under such circumstances as may be determined by the Owner, such materials may be stored in a bonded warehouse. The location and conditions for storage of such materials away from the Owner's property in a bonded warehouse shall be within the sole discretion of the Owner. Requests for Payment on account of stored materials shall be accompanied by paid invoices, bills of sale, warehouse receipts, or other documentary evidence establishing Owner's title to such materials, evidence that the stored materials are insured against loss and damage, and such other documentation as required by the Designer. Responsibility for the quantity, quality, and condition of such stored materials, whether stored on the Owner's property or away from the Owner's property, shall remain with the Contractor regardless of ownership or title. No payment shall be made on account of materials stored in a bonded warehouse unless the Contractor has acquired written permission from the Designer for such storage of materials and has complied with all conditions set forth in such permission regarding such storage of materials in a bonded warehouse. 20.4 Any Request for Payment received by the Designer on or before the fifth (5th) of the calendar month shall be certified for payment or returned for re-submission to the Contractor on or before the fifteenth (15th) of the calendar month. The Designer's certification shall be for the amount which was requested or that which the Designer has decided was justly due, and shall state in writing to the Contractor and Owner the reasons for withholding payment of any or all of the amount requested. 20.5 The Designer may fail to certify all or part of any payment requested for any of the following reasons: DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 39 Revised 12/18 a) Defective Work not corrected. b) Suits, actions, or claims of any character filed against the Contractor, or due to the operations of the Contractor, or information or notice that a suit, action, or claim will be filed or has been made. c) Information or notice that a Subcontractor or a supplier has not received payment. d) The balance unpaid of the Contract Price is insufficient to complete the Work in the judgment of the Designer or Owner. e) Damage to the Owner or another contractor. f) Inability of the Contractor to meet a Completion Date, including an anticipated failure to meet a Completion Date entitling the Owner to withhold anticipated Liquidated Damages in accordance with paragraphs 13.15 and 13.17 hereof. g) Failure to furnish Submittal as required by the Contract Documents on a timely basis in accordance with the Submittal Register. h) Such other reason as to the Designer may appear prudent, proper, or equitable. When grounds for withholding certification have been corrected, the Designer shall so certify to the Owner and the Owner shall make any payment due with respect to such certification as a part of his next payment after such certification. 20.6 No certificate issued or progress payment made shall constitute an acceptance of the Work or any part thereof. 20.7 The amount certified by the Designer for payment shall be ninety-five percent (95%) of the value of Work completed and materials stored since the Designer's last certification as shown on the Request for Payment, less any amounts not certified in accordance with paragraph 20.4, and this amount shall be paid by the Owner on or before the last business day of the month, but payment shall not be past due until not paid within fifteen (15) days thereafter. 20.8 After certification by the Designer that the Work is fifty percent (50%) complete, based on a determination that the Contractor's gross project invoices, excluding the value of materials stored off-site, equal or exceed fifty percent (50%) of the value of the Contract, (except the value of materials stored on-site shall not exceed twenty percent (20%) of the Contractor's gross project invoices for the purpose of determining whether the Project is fifty percent (50%) complete) and the Contractor has provided to the Owner the written consent of its sureties to the cessation of further percentage retention, the amount certified for payment with respect to subsequent Requests for Payment shall be one hundred percent (100%) of the value of Work completed and materials stored since the Designer's last certification as shown on the Request for Payment, less any amounts not certified in accordance with paragraphs 20.4 and 20.5; provided, however, that the aggregate of periodic payments shall not exceed ninety-seven and one half percent (97.5%) of the Contract Price. If the Owner determines that the Contractor's performance under the Contract is unsatisfactory, the Owner may resume withholding percentage retention from each subsequent periodic payment application up to the maximum amount of five percent (5%) of the Contract Price. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 40 Revised 12/18 ARTICLE 21. FINAL PAYMENT 21.1 If the Work of the Contractor is limited to demolition, pilings, caissons and/or structural steel, the remaining unpaid balance of the Contractor’s Contract Price, less a sum equal to five- tenths percent (0.5%) of the Contract Price, shall be paid within sixty days following receipt of the following documents, all of which must be received before payment shall become due: (i) request for payment from the Contractor; (ii) receipt of consent from the Contractor’s surety to the payment; and (iii) approval or certification from the Designer that the work performed by the Contractor is acceptable and in accordance with the Contract Documents. 21.2 Except as set forth in paragraph 21.1, within forty five days after Substantial Completion of the Project, the remaining unpaid balance of the Contract Price shall be paid to the Contractor, less an amount equal to two and one-half times the value of punch list work or other work remaining to be completed or corrected, as reasonably estimated by the Owner. 21.3 Upon Substantial Completion, the Designer shall prepare and submit to the Contractor a deficiency list identifying all portions of the Work which are known by the Designer at that time to be incomplete or defective. Within thirty (30) days of receipt of this deficiency list, the Contractor shall complete and correct all items on that list along with all other Work required to achieve Final Completion of the Work. At any time prior to completion of the period of warranty, the Designer may submit to the Contractor a supplemental deficiency list, in which case the Contractor shall complete or correct any and all new items identified on the supplemental deficiency list within the time period stipulated in paragraph 18.3. 21.4 Final Payment of any remaining balance of the Contract Price shall not be due to the Contractor until the Contractor achieves Final Completion of the Project. 21.5 The making and acceptance of Final Payment shall constitute a waiver of all claims by the Owner except: a) Claims arising from unsettled liens or claims against the Contractor. b) Defective Work or materials appearing after Final Payment. c) Failure of the Contractor to perform the Work in accordance with the Contract Documents. d) As conditioned in the Performance Bond. e) Claims made prior to Final Payment which remain unsettled. f) Amounts due arising under Articles 18 and 28. g) Claims for recovery of overpayment based upon incorrect measurement, estimate, or certificate. 21.6 The making and acceptance of Final Payment shall constitute a waiver of all claims by the Contractor except those claims previously made in writing pursuant to paragraph 15.2 and DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 41 Revised 12/18 not finally resolved. 21.7 The Designer shall not authorize Final Payment until all of the Work under the Contract Documents has been certified by the Designer as completed, proper and suitable for occupancy and use, and has been approved by all federal, state and local agencies having jurisdiction. 21.8 The final Request for Payment shall be identified on its face as such and shall be presented by the Contractor to the Designer within thirty (30) days of completion of the Work. Final payment of the retained amount due the Contractor shall be made by the Owner within thirty (30) days after the later of (i) full and Final Completion of all Work required by the Contract Documents, and certification of such Work in accordance with paragraph 20.4; (ii) submission of the affidavits of other documentation required by Article 22; (iii) submission by the Contractor of a Request for Payment identified on its face as final and including the Designer's certification. ARTICLE 22. CONTRACTOR, SUBCONTRACTOR AND SUPPLIER AFFIDAVIT 22.1 The Final Payment due the Contractor on account of the Contract Documents shall not become due until the Contractor has furnished to the Owner through the Designer: (A) an affidavit by the Contractor signed, sworn, and notarized to the effect that all payments for materials, services, or for any other reason in connection with the Work or performance of the Contract Documents have been satisfied and that no claims or liens exist against the Contractor in connection with the same; (B) affidavits from each Subcontractor and supplier signed, sworn, and notarized to the effect that (i) each such Subcontractor or supplier has been paid in full by the Contractor for all Work performed and/or materials supplied by him in connection with the Project, and (ii) that all payments for materials, services, and for any other reason in connection with the subcontract or supply contract have been satisfied and that no claims or liens exist against the Subcontractor or supplier in connection therewith; and (C) the written consent of the Contractor’s sureties to Final Payment. In the event that the Contractor cannot obtain an affidavit, as required above, from any Subcontractor or supplier, the Contractor shall state in the Contractor’s affidavit that no claims or liens exist against such Subcontractor or supplier to the best of the Contractor's knowledge, and that if any appear afterwards, the Contractor shall save the Owner harmless for all costs and expenses, including attorneys’ fees, on account thereof. ARTICLE 23. ASSIGNMENTS AND SUBCONTRACTS 23.1 The Contractor shall not assign any portion of this Agreement nor subcontract the Work in its entirety without the prior written consent of the Owner. Except as may be required under terms of the bonds required by the Contract Documents, no funds or sums of money due or to become due to the Contractor under the Contract Documents may be assigned. ARTICLE 24. MEASUREMENTS 24.1 Before ordering material or doing Work which is dependent for proper size or installation upon coordination with building conditions, the Contractor shall verify all dimensions and shall be responsible for the correctness of same. No consideration will be given for any claim based on differences between the actual dimensions and those indicated in the Contract Documents. Any discrepancies between the Contract Documents and the existing conditions shall be referred to the Designer for adjustment before any Work affected thereby is begun. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 42 Revised 12/18 ARTICLE 25. CONTRACTOR AND SUBCONTRACTOR RELATIONSHIPS 25.1 Within thirty (30) days after initial receipt of the Construction Contract for signatures the Contractor shall submit to the Designer and Owner for acceptance a current list of the names of Subcontractors and such other persons and organizations (including those who are to furnish materials or equipment fabricated to a special design) proposed for any and all portions of the Work. The Contractor shall provide this list at this time even if the Contractor was required to submit a list of proposed Subcontractors with the Contractor’s bid. The Designer shall promptly reply to the Contractor in writing stating whether or not the Owner or the Designer, after due investigation, has objection to any such proposed person or entity or if it needs additional information to evaluate the persons on the list. Failure of the Designer to reply within ten (10) days after the Contractor has furnished all required information shall constitute notice of no objection. The Contractor shall not contract with any such proposed person or entity to whom the Owner or the Designer has made reasonable objection. If the Designer or Owner has reasonable objection to any such proposed person or entity, the Contractor shall submit a substitute to whom the Owner and the Designer have no reasonable objection. The Contractor shall make no substitution for any Subcontractor, person, or entity previously allowed without first notifying the Designer and Owner in writing and no substitution may be made if the Owner or Designer makes a reasonable objection to such substitution. 25.2 The Contractor agrees that the terms of the Contract Documents, including all portions thereof, shall apply to all Subcontractors of the Contractor as if they were the Contractor, and that the Subcontractors of the Contractor shall, by means of their subcontracts, be bound by all the terms of the Contract Documents including, but not limited to, Article 26 of these General Conditions. 25.3 Payments to Subcontractors shall be made in accordance with the provisions of N.C. Gen. Stat. §143-134.1. ARTICLE 26. USE OF PREMISES 26.1 The Contractor shall confine apparatus, the storage of materials, the operations of workers, and the disposal of material to limits indicated by law, ordinances, permits, and directions of the Designer, if any. 26.2 The Contractor shall not load or permit any part of the Work to be loaded with a weight that will endanger its safety, intended performance, or configuration. 26.3 The Contractor shall enforce all of the Designer's instructions, including, but not limited to, those regarding signs, advertisements, fires, and smoking. ARTICLE 27. CUTTING, PATCHING AND FITTING DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 43 Revised 12/18 27.1 The Contractor shall do all cutting, fitting, and patching of the Work that may be required to make its several parts come together properly and fit it to receive or to be received by Work shown in or which can be reasonably implied from the Contract Documents. ARTICLE 28. DISPUTE RESOLUTION 28.1 The laws of the State of North Carolina shall apply to the interpretation and enforcement of this Agreement. Any and all suits or actions to enforce, interpret, or seek damages with respect to any provision of, or the performance or nonperformance of, this Agreement shall be brought in the General Court of Justice of North Carolina sitting in Orange County, North Carolina, and it is agreed by the parties that no other court shall have jurisdiction or venue with respect to such suits or actions. In any dispute arising pursuant to the terms of this Agreement the Parties shall follow and abide by the Rules and Procedures for Orange County Design, Building Construction, Renovation, and Repair Projects. The policy is incorporated herein by reference and may be viewed at http://www.orangecountync.gov/departments/purchasing_division/contracts.php). Regardless of the outcome of any dispute each Party shall be responsible for its own legal costs including reasonable attorneys’ fees. 28.2 Any person or firm that expressly or impliedly agrees to perform labor or services or to provide material, supplies, equipment, work, performance or payment bonds, insurance or indemnification for the construction of the Project or the Work shall be deemed a party to this Agreement solely for the purpose of this Article 28. The Contractor, by means of its subcontracts, shall specifically require its Subcontractors to be bound by this Article. ARTICLE 29. TAXES 29.1 The Contractor has included in the Contract Price and shall pay all taxes assessed by any authority on the Work or the labor and materials used therein. The Contractor shall maintain all tax records during the life of the Project and furnish the Owner with a complete listing of all taxes paid by taxing authority, invoice number, date, amount, etc. in a form acceptable to the Owner. The Contractor is required to maintain a file showing taxes paid on the Project for three (3) years after Final Payment or turn said documents over to the Owner for his files. 29.2 The following is a list of requirements to be followed by the Contractor in maintaining proper records and reporting the North Carolina Sales and Use Tax and Local Sales and Use Tax. The Contractor shall comply fully with the requirements outlined below, in order that the Owner may recover the amount of the tax permitted under the law. a) It shall be the Contractor's responsibility to furnish the Owner documentary evidence showing the materials used and sales and use tax paid by the Contractor and each of his Subcontractors. Such evidence shall be transmitted to the Owner with each pay request regardless of whether taxes were paid in that period. b) The documentary evidence shall consist of a certified statement by the Contractor and each of the Contractor’s Subcontractors individually, showing total purchases of materials from each separate vendor and total sales and use taxes paid to each vendor. Certified statements must show the invoice number, or numbers, covered, and inclusive dates of such invoices. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 44 Revised 12/18 c) Materials used from Contractor's or Subcontractor's warehouse stock shall be shown in a certified statement at warehouse stock prices. d) The Contractor shall not be required to certify the Subcontractor's statements. ARTICLE 30. OPERATION OF OWNER'S FACILITIES 30.1 The Contractor agrees that all Work done under the Contract Documents shall be carried on in such a manner so as to ensure the regular and continuous operation of the adjoining or adjacent facilities. The Contractor further agrees that the sequence of operations under the Contract Documents shall be scheduled and carried out so as to ensure said regular and continuous operation. The Contractor shall not close any areas of construction until so authorized by the Designer. The Contractor shall control operations to assure the least inconvenience to the public. Under all circumstances, safety shall be the most important consideration. ARTICLE 31. THIRD PARTY BENEFICIARY CLAUSE 31.1 It is specifically agreed between the parties executing the Agreement that, with the specific exception set forth paragraph 7.24 hereof, and that exception only, the Contract Documents and the provisions therein are not intended to make the public, or any member thereof, a third-party beneficiary of the Agreement, or to authorize anyone not a party to the Contract Documents to maintain a suit for personal injuries or property damage pursuant to the terms of provisions of the Contract Documents. ARTICLE 32. MEASUREMENT OF QUANTITIES 32.1 All Work completed under the Contract Documents shall be measured by the Contractor using United States customary units of measurement. The method of measurement and computations to be used in determination of quantities of material furnished and of Work performed under the Contract Documents shall be those methods set forth in the Contract Documents or, if not specifically set forth therein, the method generally recognized as conforming to good engineering practice. ARTICLE 33. TERMINATION BY THE OWNER FOR CAUSE 33.1 If the Contractor fails to begin or complete the Work under the Contract Documents within the time specified, or fails to perform the Work with sufficient labor and equipment or with sufficient materials to insure the prompt completion of said Work, or shall perform the Work unsuitably or shall discontinue the prosecution of the Work for three (3) days, or if the Contractor shall become insolvent, be declared bankrupt, commit any act of bankruptcy or insolvency, allow any final judgment to stand against the Contractor or its affiliated companies unsatisfied for a period of forty-eight (48) hours, make an assignment for the benefit of creditors, or for any other cause whatsoever shall not carry on the Work in an acceptable manner, the Owner may give notice in writing to the Contractor and the Contractor’s sureties of such delay, neglect, or default, specifying the same, and if the Contractor within a period of three (3) days after such notice shall not proceed in good faith and with reasonable speed to correct such delay, neglect, or default in accordance with such notice, the Owner shall have full power and authority, to the extent permitted by law, without violating the Contract Documents, to take the DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 45 Revised 12/18 prosecution of the Work out of the hands of the Contractor, to appropriate or use any or all materials and equipment at the Project as may be suitable and acceptable, and may enter into an agreement for the completion of the Work or pursue such other methods as in the Owner's opinion shall be necessary or appropriate for the completion of the Work in an acceptable manner. All costs and charges incurred by the Owner in proceeding in accordance with the preceding sentence, including attorney's fees, and all costs incurred by the Owner in completing the Work shall be deducted from any money due or which becomes due the Contractor. If such costs and expenses incurred by the Owner shall be less than the sum which would have been payable under Contract Documents if it had been completed by the Contractor, then the Contractor shall be entitled to receive the difference, but if such costs and expenses shall exceed the sum which would have been payable under the Contract Documents, the Contractor and the Contractor’s surety shall be liable to the Owner for and shall pay to the Owner the amount of such excess. ARTICLE 34. TERMINATION OR SUSPENSION BY THE OWNER FOR CONVENIENCE 34.1 The Owner may, without cause, order the Contractor to terminate, suspend, delay, or interrupt the Work in whole or in part for such period of time as the Owner may determine. 34.2 If the Contractor is subsequently ordered by the Owner to resume the Work, any cost or expenses to which the Contractor may be entitled by reason of the suspension, delay, or interruption shall be recovered by means of a Change Order in accordance with Articles 13 and 14 hereof and the Contract Construction Schedule shall be adjusted in accordance with Article 13 hereof. 34.3 In the event of termination by the Owner under this Article, the Contractor shall be entitled to receive the reasonable and documented direct costs incurred prior to termination, including the cost of materials purchased for the Work which purchases cannot be canceled or which material cannot reasonably be used by the Contractor on other work, and the cost of closing down the Project in a safe and efficient manner, plus ten percent (10%) thereof for overhead and profit, subject to the following conditions: a) When the Contract is terminated before completion of all items of Work, payment shall be made for the actual number of units or items of Work completed at the applicable contract prices, or as mutually agreed for items of Work partially complete. If a mutual agreement cannot be reached, the Owner shall have the authority to make such equitable adjustment as it deems warranted and the Final Payment shall be made accordingly. b) Reimbursement for organization of any Work and moving equipment to and from the job shall be considered when not otherwise provided for in the Contract Documents where the volume of completed Work is too small to compensate the Contractor for those expenses under unit prices. If a mutual agreement cannot be reached, the Owner will have the authority to make such equitable adjustments as it deems warranted and the Final Payment will be made accordingly. c) Materials obtained by the Contractor for the Work that have been inspected and accepted by the Designer and that are not incorporated in the Work shall, at the request of the Contractor, be purchased from the Contractor at the Contractor's actual cost as shown by receipted bills and actual costs records at such points of delivery as may be determined by the Owner. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 46 Revised 12/18 d) No payment shall be made by Owner to Contractor except as herein above provided. No claim for loss of anticipated profits shall be considered or allowed. e) Termination of the Contract shall not relieve the Contractor of his responsibilities for any completed portion of the Work nor shall it relieve his sureties of their obligation for and concerning any just claims arising out of the Work performed. The Contractor shall not be entitled to any other compensation, including compensation for lost profit, lost opportunity, or any other direct or consequential cost, loss, or damage. ARTICLE 35 MINORITY BUSINESS ENTERPRISE PROGRAM 35.1 The Contractor shall at all times comply with the Orange County Minority Business Enterprise Policy. All documentation substantiating compliance with the requirements of this program shall be delivered to the Owner as stipulated in the Contract Documents. A copy of the Orange County Minority Business Enterprise Policy is included in the Project Manual. ARTICLE 36 E-VERIFY AND DIGITAL SIGNATURES 36.1 By executing the Agreement Contractor affirms Contractor, its agents and subcontractors, are and shall remain in compliance with Article 2 of Chapter 64 of the North Carolina General Statutes. 36.2 This Agreement together with any amendments or modifications may be executed electronically. All electronic signatures affixed hereto evidence the consent of the Parties to utilize electronic signatures and intent of the Parties to comply with Article 11A and Article 40 of North Carolina General Statute Chapter 66. 36.3 By executing the Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.58. 36.4 By executing the Agreement Contractor certifies that Contractor has not been identified, and has not utilized the services of any agent or subcontractor identified, on the list created by the State Treasurer pursuant to G.S. 147-86.81. ARTICLE 37 GENERAL 37.1 If any provision of the Agreement shall be declared invalid or unenforceable, the remainder of the Agreement shall continue in full force and effect. 37.2 The titles to Articles herein are for convenience only, are not substantive parts of the General Conditions, and are not to be considered in interpreting the Contract Documents. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 47 Revised 12/18 END OF GENERAL CONDITIONS OF THE CONTRACT FOR CONSTRUCTION—EXHIBIT 1 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 1 GUIDELINES FOR RECRUITMENT AND SELECTION OF MINORITY BUSINESSES These guidelines were adapted for use on this project by the County of Orange from the “Guidelines for Recruitment and Selection of Minority Businesses for Participation in State Construction Office Projects”, developed by the State Construction Office. In accordance with G.S. 143-128.2 (SB 914 ratified December 6, 2001), the County of Orange has enacted a verifiable ten percent (10%) minority business participation goal for the total monetary value of this project. These guidelines are published to accomplish that end. SECTION 1: INTENT It is the intent of these guidelines that the County of Orange, as awarding authority for construction projects, and the contractors and subcontractors performing the construction contracts awarded shall cooperate and in good faith do all things legal, proper and reasonable to achieve the statutory goal of ten percent for participation by minority businesses in each construction project permitted by SB 914. Nothing contained in these guidelines shall be considered to require awarding authorities to award contracts or to make purchase of materials or equipment from minority-business contractors who do not submit the lowest responsible bid or bids. SECTION 2: DEFINITIONS 1. Minority - a person who is a citizen or lawful permanent resident of the United States and who is: a. Black, that is, a person having origins in any of the black racial groups in Africa; b. Hispanic, that is, a person of Spanish or Portuguese culture with origins in Mexico, South or Central America, or the Caribbean Islands, regardless of race; c. Asian American, that is, a person having origins in any of the original peoples of the Far East, Southeast Asia and Asia, the Indian subcontinent, the Pacific Islands; d. American Indian or Alaskan Native, that is , a person having origins in any of the original peoples of North America; e. Female. f. “Socially disadvantaged individual”, as defined in 15 U.S.C. 637. These are individuals who have “been subjected to racial or ethnic prejudice or cultural bias because of their identify as a member of a group without regard to their individual qualities”; or g. “Economically disadvantaged individual” as defined in 15 U.S.C. 637. This is an individual “whose ability to compete in the free enterprise system has been impaired due to diminished capital and credit opportunities as compared to others in the same business who are not socially disadvantaged.” 2. Minority Business - means a business: a. In which at least fifty-one percent (51%) is owned by one or more minority persons, or in the case of a corporation, in which at least fifty-one percent (51%) of the stock is owned by one or more minority persons; and DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 2 b. Of which the management and daily business operations are controlled by one or more of the minority persons who own it. 3. Owner - The County of Orange. 4. Bidder - Any person, firm, partnership, corporation, association, or joint venture seeking to be awarded a public contract or subcontract. 5. Contract - A mutually binding legal relationship or any modification thereof obligating the seller to furnish equipment, material or services, including construction, and obligating the buyer to pay for them. 6. Contractor - Any person, firm, partnership, corporation, association, or joint venture which has contracted with the County of Orange to perform construction work or repair. 7. Subcontractor - A firm under contract with the Prime Contractor for supplying materials or labor and materials and/or installation. The subcontractor may or may not provide materials in his subcontract. Work subcontracted in an emergency and which could not have been anticipated is excluded as a part of this program. 8. Verifiable goal means that the awarding authority has adopted written guidelines specifying the actions that the prime contractor must take to ensure a good faith effort in the recruitment and selection of minority businesses for participation in contracts awarded; the required actions must be documented in writing by the contractor to the appropriate awarding authority. SECTION 3: RESPONSIBILITIES 1. Minority Business Program of the County of Orange (hereafter referred to a Minority Business Program). The Minority Business Program will establish a program pursuant to which it shall certify to interested persons, businesses qualifying as Minority Business Enterprises (MBE). The information solicited from the applicant will be used by the Minority Business Program to: a. Determine MBE certification, i.e., that those certified are MBEs under GS 143- 128 as a contractor and/or subcontractor. b. Identify those areas of work for which there are certified MBEs, as requested. c. Provide interested parties with a list of prospective certified MBE contractors and subcontractors. d. Assist in the determination of technical assistance in the certification program that needs to be provided. In addition to being responsible for the certification of those small and emerging businesses that want to participate, the Minority Business Program will: 1. Maintain a current list of certified MBEs of those certified. The list furnished shall include the areas of work in which each MBE is interested. 2. Work with the North Carolina Association of Minority Businesses, the Carolinas Branch AGC, the Carolina Electrical Contractors Association and the North Carolina Association of Plumbing-Heating-Cooling Contractors in developing and implementing a certification program intended to improve the ability of MBE’s to compete in this program. 2. Owner DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3 The owner will: a. Attend the scheduled prebid conference. b. Identify or determine those work areas of a contract where MBEs may have an interest in performing contract work. c. At least ten (10) days prior to the scheduled day of bid opening, the Owner will notify certified MBEs of potential contracting opportunities listed in the proposal. The notification will include the following: 1. A description of the work for which the bid is being solicited. 2. The date, time and location where bids are to be submitted. 3. The name of the individual within the agency/institution who will be available to answer questions about the project. 4. Where bid documents may be reviewed. 5. Any special requirements that may exist, such as insurance, licenses, bonds and financial arrangements. If there are more than three (3) certified MBEs in the general locality of the project who offer similar contracting or subcontracting services in the specific trade, the Owner shall notify three (3) , but may contact more, if the Owner so desires. d. Maintain documentation of any contacts, correspondence, or conversations with MBE firms made in an attempt to meet the goals. 2. Prime Contractor Under the single prime contract system, the prime contractor will: a. Attend the scheduled prebid conference. b. Identify or determine those work areas of a contract where MBEs may have an interest in performing contract work. c. At least ten (10) days prior to the scheduled day of bid opening, notify certified MBEs of potential contracting opportunities listed in the proposal. The notification will include the following: 1. A description of the work for which the bid is being solicited. 2. The date, time and location where bids are to be submitted. 3. The name of the individual within the agency/institution who will be available to answer questions about the project. 4. Where bid documents may be reviewed. 5. Any special requirements that may exist, such as insurance, licenses, bonds and financial arrangements. If there are more than three (3) certified MBEs in the general locality of the project who offer similar contracting or subcontracting services in the specific trade, the Contractor shall notify three (3) , but may contact more, if the Contractor so desires. d. During the bidding process, comply with the contractor(s) requirements listed in the proposal for minority participation. e. Submit with the bid a description of that portion of the work to be executed by MBEs expressed as a percentage of the total price. f. Identify the MBEs the bidder intends to use on the contract, along with the dollar amount of the work to be performed by each minority business. g. Submit an affidavit that details the good faith efforts taken to procure minority business participation. h. Upon being named the apparent low bidder, the bidder shall provide the necessary DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 4 documentation as listed in the contract documents. Failure to comply with procedural requirements as defined in contract documents may render that bid as non-responsive and may result in rejection of the bid and award to the next lowest responsible and responsive bidder. i. Upon being named apparent low bidder, the bidder shall provide an affidavit that lists the proportion of the work to be performed by MBEs. If the MBEs do not account for ten percent (10%) of the contract price, the bidder must submit an affidavit that verifies the bidder’s good faith efforts by certifying that it has undertaken at least five of the following ten (10) steps: 1. Contacted minority businesses that reasonably could have been expected to submit a quote and that were known to the contract or available on these State or local government-maintained lists at least ten (10) days before the bid or proposal date and notifying them of the nature and scope of the work to be performed. 2. Made the construction plans, specifications, and requirements available for review by prospective minority businesses, or providing these documents to them at least ten (10) days before the bid proposals are due. 3. Broke down or combined elements of work into economically feasible units to facilitate minority participation. 4. Worked with minority trade, community, or contractor organizations identified by the Office of Historical Underutilized Businesses and included in the bid documents that provided assistance in recruitment of minority businesses. 5. Attended any prebid meetings scheduled by the public owner. 6. Provided assistance in getting required bonding or insurance or providing alternatives to bonding or insurance for subcontractors. 7. Negotiated in good faith with interested minority businesses and did not reject them as unqualified without sound reasons based on their capabilities. Any rejection of a minority business based on lack of qualifications should have the reasons documented in writing. 8. Provided assistance to an otherwise qualified minority business in need of equipment, loan capital, lines of credit, or joint pay agreements to secure loans, supplies, or letters of credit, including waiving credit that is ordinarily required. Assisted minority businesses in obtaining the same unit pricing with the bidder’s suppliers in order to help the minority businesses in establishing credit. 9. Negotiated joint venture and partnership arrangements with minority businesses in order to increase opportunities for minority business participation on a public construction or repair project when possible. 10. Provide quick pay agreements and policies to enable minority contractors and suppliers to meet cash-flow demands. j. During the construction of the project, if it becomes necessary to replace an MBE subcontractor, advise the owner of the circumstances involved. k. If, during the construction of a project, additional subcontracting opportunities become available, make a good faith effort to solicit subbids from MBEs. 3. MBE Responsibilities DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 5 While MBEs are not required to become certified in order to participate in this program, it is recommended that they become certified and should take advantage of the appropriate technical assistance that is made available. In addition, MBEs who are contacted by owners or bidders must respond promptly whether or not they wish to submit a bid. SECTION 4: DISPUTE PROCEDURES It is the policy of this County that disputes between an agency and another person that involve a person’s rights, duties, or privileges should be settled through informal procedures. To that end, MBE disputes arising under these guidelines should be resolved, if possible, by informal proceedings arranged by the Owner. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid MBForms 2002-Revised July 2010 Identification of HUB Certified/ Minority Business Participation I, , (Name of Bidder) do hereby certify that on this project, we will use the following HUB Certified/ minority business as construction subcontractors, vendors, suppliers or providers of professional services. Firm Name, Address and Phone # Work Type *Minority **HUB Category Certified (Y/N) *Minority categories: Black, African American (B), Hispanic (H), Asian American (A) American Indian (I), Female (F) Socially and Economically Disadvantaged (D) ** HUB Certification with the state HUB Office required to be counted toward state participation goals. The total value of minority business contracting will be ($) . DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid MBForms 2002-Revised July 2010 State of North Carolina AFFIDAVIT A –Listing of Good Faith Efforts County of (Name of Bidder) Affidavit of I have made a good faith effort to comply under the following areas checked: Bidders must earn at least 50 points from the good faith efforts listed for their bid to be considered responsive.(1 NC Administrative Code 30 I.0101)1 – (10 pts) Contacted minority businesses that reasonably could have been expected to submit a quote and that were known to the contractor, or available on State or local government maintained lists, at least 10 days before the bid date and notified them of the nature and scope of the work to be performed.2 --(10 pts)Made the construction plans, specifications and requirements available for review by prospective minority businesses, or providing these documents to them at least 10 days before the bids are due.3 –(15 pts) Broken down or combined elements of work into economically feasible units to facilitate minority participation.4 – (10 pts)Worked with minority trade, community, or contractor organizations identified by the Office of Historically Underutilized Businesses and included in the bid documents that provide assistance in recruitment of minority businesses.5 –(10 pts) Attended prebid meetings scheduled by the public owner.6 –(20 pts)Provided assistance in getting required bonding or insurance or provided alternatives to bonding or insurance for subcontractors.7 – (15 pts)Negotiated in good faith with interested minority businesses and did not reject them as unqualified without sound reasons based on their capabilities. Any rejection of a minority business based on lack of qualification should have the reasons documented in writing.8 –(25 pts)Provided assistance to an otherwise qualified minority business in need of equipment, loan capital, lines of credit, or joint pay agreements to secure loans, supplies, or letters of credit, including waiving credit that is ordinarily required. Assisted minority businesses in obtaining the same unit pricing with the bidder's suppliers in order to help minority businesses in establishing credit.9 –(20 pts)Negotiated joint venture and partnership arrangements with minority businesses in order to increase opportunities for minority business participation on a public construction or repair project when possible.10 -(20 pts)Provided quick pay agreements and policies to enable minority contractors and suppliers to meet cash-flow demands. The undersigned, if apparent low bidder, will enter into a formal agreement with the firms listed in the Identification of Minority Business Participation schedule conditional upon scope of contract to be executed with the Owner. Substitution of contractors must be in accordance with GS143-128.2(d) Failure to abide by this statutory provision will constitute a breach of the contract. The undersigned hereby certifies that he or she has read the terms of the minority business commitment and is authorized to bind the bidder to the commitment herein set forth. Date: Name of Authorized Officer: Signature: Title: State of______________, County of Subscribed and sworn to before me this day of 20 Notary Public My commission expires SEAL DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid Attach to Bid MBForms 2002-Revised July 2010 State of North Carolina --AFFIDAVIT B-- Intent to Perform Contract with Own Workforce. County of Affidavit of (Name of Bidder) I hereby certify that it is our intent to perform 100% of the work required for the contract. (Name of Project) In making this certification, the Bidder states that the Bidder does not customarily subcontract elements of this type project, and normally performs and has the capability to perform and will perform all elements of the work on this project with his/her own current work forces; and The Bidder agrees to provide any additional information or documentation requested by the owner in support of the above statement. The Bidder agrees to make a Good Faith Effort to utilize minority suppliers where possible. The undersigned hereby certifies that he or she has read this certification and is authorized to bind the Bidder to the commitments herein contained. Date: Name of Authorized Officer: Signature: Title: State of _________ __ , County of ________________________ Subscribed and sworn to before me this day of 20___ Notary Public My commission expires SEAL DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Do not submit with bid Do not submit with bid Do not submit with bid Do not submit with bid MBForms 2002-Revised July 2010 State of North Carolina - AFFIDAVIT C -Portion of the Work to be Performed by HUB Certified/Minority Businesses County of (Note this form is to be submitted only by the apparent lowest responsible, responsive bidder.) If the portion of the work to be executed by HUB certified/minority businesses as defined in GS143- 128.2(g) and 128.4(a),(b),(e) is equal to or greater than 10% of the bidders total contract price, then the bidder must complete this affidavit. This affidavit shall be provided by the apparent lowest responsible, responsive bidder within 72 hours after notification of being low bidder. Affidavit of I do hereby certify that on the (Name of Bidder) (Project Name) Project ID#Amount of Bid $ I will expend a minimum of % of the total dollar amount of the contract with minority business enterprises. Minority businesses will be employed as construction subcontractors, vendors, suppliers or providers of professional services. Such work will be subcontracted to the following firms listed below.Attach additional sheets if required Name and Phone Number *Minority Category **HUB Certified Y/N Work Description Dollar Value *Minority categories: Black, African American (B), Hispanic (H), Asian American (A) American Indian (I), Female (F) Socially and Economically Disadvantaged (D) ** HUB Certification with the state HUB Office required to be counted toward state participation goals. Pursuant to GS143-128.2(d), the undersigned will enter into a formal agreement with Minority Firms for work listed in this schedule conditional upon execution of a contract with the Owner. Failure to fulfill this commitment may constitute a breach of the contract. The undersigned hereby certifies that he or she has read the terms of this commitment and is authorized to bind the bidder to the commitment herein set forth. Date: Name of Authorized Officer: Signature: Title: State of , County of Subscribed and sworn to before me this day of 20 Notary Public My commission expires SEAL DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Do not submit with the bid Do not submit with the bid Do not submit with the bid Do not submit with the bid Do not submit with the bid MBForms 2002-Revised May 2010 -1- State of North Carolina AFFIDAVIT D –Good Faith Efforts County of (Note this form is to be submitted only by the apparent lowest responsible, responsive bidder.) If the goal of 10% participation by HUB Certified/ minority business is not achieved, the Bidder shall provide the following documentation to the Owner of his good faith efforts: Affidavit of I do hereby certify that on the (Name of Bidder) (Project Name) Project ID#Amount of Bid $ I will expend a minimum of % of the total dollar amount of the contract with HUB certified/ minority business enterprises. Minority businesses will be employed as construction subcontractors, vendors, suppliers or providers of professional services. Such work will be subcontracted to the following firms listed below.(Attach additional sheets if required) Name and Phone Number *Minority Category **HUB Certified Y/N Work Description Dollar Value *Minority categories: Black, African American (B), Hispanic (H), Asian American (A) American Indian (I), Female (F) Socially and Economically Disadvantaged (D) ** HUB Certification with the state HUB Office required to be counted toward state participation goals. Examples of documentation that may be required to demonstrate the Bidder's good faith efforts to meet the goals set forth in these provisions include, but are not necessarily limited to, the following: A. Copies of solicitations for quotes to at least three (3) minority business firms from the source list provided by the State for each subcontract to be let under this contract (if 3 or more firms are shown on the source list). Each solicitation shall contain a specific description of the work to be subcontracted, location where bid documents can be reviewed, representative of the Prime Bidder to contact, and location, date and time when quotes must be received. B. Copies of quotes or responses received from each firm responding to the solicitation. C. A telephone log of follow-up calls to each firm sent a solicitation. D. For subcontracts where a minority business firm is not considered the lowest responsible sub-bidder, copies of quotes received from all firms submitting quotes for that particular subcontract. E. Documentation of any contacts or correspondence to minority business, community, or contractor organizations in an attempt to meet the goal. F. Copy of pre-bid roster G. Letter documenting efforts to provide assistance in obtaining required bonding or insurance for minority business. H. Letter detailing reasons for rejection of minority business due to lack of qualification. I. Letter documenting proposed assistance offered to minority business in need of equipment, loan capital, lines of credit, or joint pay agreements to secure loans, supplies, or letter of credit, including waiving credit that is ordinarily required. Failure to provide the documentation as listed in these provisions may result in rejection of the bid and award to the next lowest responsible and responsive bidder. Pursuant to GS143-128.2(d), the undersigned will enter into a formal agreement with Minority Firms for work listed in this schedule conditional upon execution of a contract with the Owner. Failure to fulfill this commitment may constitute a breach of the contract. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Do not submit with the bid Do not submit with the bid Do not submit with the bid Do not submit with the bid Do not submit with the bid MBForms 2002-Revised May 2010 -2- The undersigned hereby certifies that he or she has read the terms of this commitment and is authorized to bind the bidder to the commitment herein set forth. Date: Name of Authorized Officer: Signature: Title: State of , County of Subscribed and sworn to before me this day of 20 Notary Public My commission expires SEAL DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Section I: General Government and Administration Policy 10.0: Living Wage Contractor Policy Reviewed by: County Attorney/County Manager Approved by: County Manager Original Effective Date: April 21, 2016 Revisions: Policy Statement It is the policy of Orange County to ensure its employees, and all individuals who provide services for Orange County, are paid a living wage. Purpose To encourage all vendors and contractors to pay a living wage to all employees who perform work pursuant to a contract with Orange County. Applicability Applies to all Orange County contracts and purchases. Policy 10.1 Living Wage 10.1.1 Orange County is committed to providing its employees with a living wage and encourages all contractors and vendors doing business with Orange County to pursue the same goal. Orange County’s living wage is $12.76 per hour. To the extent possible, Orange County recommends that contractors and vendors seeking to do business with Orange County provide a living wage to their employees. 10.1.2 Prior to final execution of a contract with Orange County all contractors and vendors seeking to do business with Orange County shall submit to the County’s representative a statement indicating whether those employees who will perform work on the Orange County contract are paid at least the living wage amount set out above. If such employees do not make at least the living wage amount set out above the contractor or vendor shall indicate in the statement the actual amount paid to such employees. For bid projects this statement should be submitted as part of the bid packet. This policy may be reviewed annually and updated as needed by the Manager’s Office DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. Coverage Low Risk Profile Standard Risk Profile High Risk Profile Specialty Encroachment Premises Lease Commercial General Liability Products/Completed Operation Explosion, Collapse & Underground (XCU) $1,000,000/$2,000,000 Per accident As above $1,000,000/$2,000,000 As Above If any, Limit to be determined. $1,000,000/$2,000,000 As above If any, TBD. $1,000,000* As Above If any, TBD. $1,000,000 $1,000,000 Automobile Liability $1,000,000 (CSL) Per occurrence $1,000,000* $1,000,000* $1,000,000* N/A N/A **Workers’ Compensation Statutory Statutory Statutory Statutory N/A Statutory **Employer’s Liability 100/500/100 500/500/500* 500/500/500 500/500/500* N/A 100/500/100 ** Waiver of Subrogation on WC Required if available Required if available Required Required N/A N/A Umbrella Liability $1,000,000 $2,000,000 $2,000,000+ $9,000,000+ N/A N/A Professional Liability may be required on a risk profile depending on nature of services provided by contract. Coverage required for professional service such as accountant, attorney, architect, design, engineering, health care and most consultants. $1,000,000 per occurrence $1,000,000 TBD TBD N/A N/A Sexual Misconduct (Sexual Abuse/Molestation) may be required for contractors working directly one-on-one with children and elderly or in overnight sheltering capacities. $1,000,000/$2,000,000 $1,000,000/$2,000,000 TBD TBD N/A TBD Cyber Liability may be required for contractors having access to personal identifying information, and/or computer networks. $1,000,000/$2,000,000 TBD TBD TBD N/A Environmental/Pollution Liability required if demolition, use of N/A $1,000,000 $1,000,000+* $1,000,000+* N/A N/A DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Orange County Minimum Insurance Coverage Requirements Note: An Exception or Waiver of Minimum Coverage may only be granted at the discretion and approval of Risk Management based on assessment of risk posed to the county. hazardous material or environmentally sensitive Fidelity Bond (loss of money or other property due to dishonest acts). Only for contracts such as Banking, Janitorial, Fundraising, TPA’s and similar, ETA TBD Amount depends on exposure to loss TBD TBD N/A N/A Other Coverage As required TBD TBD TBD TBD N/A N/A Bid, Performance & Payment Bonds TBD TBD TBD TBD N/A N/A *A combination of Umbrella/Excess and primary limit may be used to provide coverage for the amount shown. ** Workers’ Compensation is required if the contractor/vendor has employees. Owner Waiver is acceptable for a Sole Proprietor. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 ORANGE COUNTY NORTH CAROLINA DISPUTE RESOLUTION RULES AND PROCEDURES FOR ORANGE COUNTY DESIGN, BUILDING CONSTRUCTION, RENOVATION, AND REPAIR PROJECTS RULE 1. INITIATING MEDIATED SETTLEMENT CONFERENCES A. Purpose of Mandatory Settlement Conferences. Pursuant to G.S. §143‐128(f1) and 143‐ 135.26(11), these Rules are promulgated to implement a mediated settlement program designed to focus the parties’ attention on settlement rather than on claim preparation and to provide an opportunity for orderly settlement negotiations to take place. Nothing herein is intended to limit or prevent the parties from engaging in settlement procedures voluntarily at any time prior to or during commencement of the dispute resolution process. B. Initiating the Dispute Resolution Process 1. Any party to a County public construction contract (referred to herein generally as the “Contract”) governed by Article 8. Ch. 143 of the General Statutes and identified in G.S. § 143‐ 128(f1) and who is a party to a dispute arising out of the Contract and the construction process in which the amount in controversy is at least $15,000 may submit a written request to the County for mediation of the dispute. 2. Prior to submission of a written request for mediation to the County, the party requesting mediation should give notice of any and all claims in accordance with their respective contracts, obtain decisions on the claims as required or allowed by their respective contracts, and attempt to resolve the dispute according to the terms and conditions in their respective contracts. The Mediator may adjourn any mediated settlement conference if the Mediator believes, in his or her sole discretion, that the parties have not satisfied all of the terms and conditions of their respective contracts and that doing so will enhance the prospects for a negotiated settlement. C. Condition Precedent to Litigation. Before any party to a Contract may commence a civil action against the County seeking remedies for breach or non‐performance of the Contract by the County, said party must first initiate the dispute resolution process under these rules and attend and participate in good faith in the mediated settlement conference. RULE 2. SELECTION OF MEDIATOR A. Mediator Listing. A List of Mediators acceptable to the County is maintained by the County Attorney and that list is incorporated by reference into these Rules. B. Selection of Mediator. The party requesting mediation shall select a Mediator from the List of Mediators and shall file, with the County, a Notice of Selection of Mediator within 21 days of the request for mediation. Such notice shall state the name, address, and phone number of the Mediator selected. If the Mediator selected is not available or declines to participate for any reason, the requesting party shall select another person from the List of Mediators. If the party requesting mediation does not select DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 and designate a mediator within 21 days of the request for mediation, the County shall have the right in its absolute discretion to appoint a mediator from its List of Mediators. C. Disqualification of Mediator. Any party may request replacement of the Mediator for good cause. Nothing in this provision shall preclude Mediators from disqualifying themselves. RULE 3. THE MEDIATED SETTLEMENT CONFERENCE A. Where Conference is to be Held. Unless all parties and the Mediator otherwise agree, the mediated settlement conference shall be held in county seat of Orange County. The Mediator shall be responsible for reserving a place, making arrangements for the conference, and giving timely notice of the time and location of the conference to all attorneys, unrepresented parties and other persons or entities required to attend. B. When Conference is to be Held. The mediation shall be completed within 90 days after selection of the Mediator unless all parties to the mediation agree to a different schedule. C. Request to Accelerate or Extend Deadline for Completion. Any party or the Mediator may request the County to accelerate or extend the deadline for completion of the conference. Such request shall state the reasons the acceleration or extension is sought and shall be served by the moving party upon the other parties and the Mediator. Objections to the request must be promptly communicated to the County and to the Mediator. The County, with the concurrence of the designated Mediator, may grant the request by adjusting the time for completion of the conference. D. Recesses. The Mediator may recess the mediation conference at any time and may set times for reconvening. If the Mediator determines the time and place where the conference is to reconvene before the conference is recessed, no further notice is required to persons present at the conference. E. Project Delay. The mediated settlement conference that results from a construction contract dispute shall not be cause for the delay of the construction project. RULE 4. DUTIES OF PARTIES AND OTHER PARTICIPANTS IN FORMAL DISPUTE RESOLUTION PROCESS A. Attendance. 1. All parties to the dispute must designate an official representative to attend the mediation. 2. “Attendance” means physical attendance, not by telephone or other electronic means. Any attendee representing a party must have authority from that party to bind it to any agreement reached as a result of the mediation. 3. Attorneys representing parties may attend the mediation, but are not required to do so. 4. Sureties and insurance company representatives are required to physically attend the mediation unless the Mediator and all of the other parties to the mediation excuse their attendance or consent to their attendance by telephone or other electronic means. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 5. The parties who attend a duly scheduled mediation conference shall have the right to recover their share of the Mediator’s compensation from any party or parties who fail to attend the conference without good cause. B. Finalizing Agreement. If an agreement is reached in the conference, the terms of the agreement shall be confirmed in writing and signed by all parties. C. Payment of Mediation Fee: Mediation Fees charged by the Mediator shall be paid in accordance with G.S. § 143‐128(f1). D. Failure to Compensate Mediator. Any party’s failure to compensate the Mediators in accordance with G.S. § 143‐128(f1) shall subject that party to a withholding by the County of said amount of money from the party’s payment or any other moneys owed by that party to the County. Should the County fail to compensate the Mediator, it shall hereby be subject to a civil cause of action from the Mediator for the County’s portion of the Mediator’s total fee as required by G.S. § 143‐128(f1). RULE 5. AUTHORITY AND DUTIES OF MEDIATORS A. Authority of Mediator. 1.Control of Conference. The Mediator shall at all times be in control of the conference and the procedures to be followed. 2.Private Consultation. The Mediator may communicate privately with any participant or counsel prior to and during the conference. The fact that private communications have occurred with a participant shall be disclosed to all other participants at the beginning of the conference. 3.Scheduling the Conference. The Mediator shall make a good faith effort to schedule the conference at a time that is convenient with the participants, attorneys and Mediator. In the absence of agreement, the Mediator shall select the date for the conference. 4.Determining good cause for a party’s failure to appear at a scheduled mediation conference. B.Duties of Mediator. 1.The Mediator shall define and describe the following at the beginning of the conference: a.The process of mediation. b.The difference between mediation and other forms of conflict resolution. c.The costs of the mediated settlement conference. d.That the mediated settlement conference is not a trial, the Mediator is not a judge, and the parties retain their legal rights if they do not reach settlement; however, the Mediator will advise all parties that failure to appear at mediation without good cause may result in imposition of sanctions and may be asserted as a bar to lawsuits by claimants who have failed to exhaust this administrative remedy. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 e.The circumstances under which the Mediator may meet and communicate privately with any of the parties or with any other person. f.Whether and under what conditions communications with the Mediator will be held in confidence during the conference. g.The inadmissibility of conduct and statements as provided by G.S. §7A‐38.1(1). h.The duties and responsibilities of the Mediator and the participants. i.That any agreement reached will be reached by mutual consent. 2. Disclosure: The Mediator has a duty to be impartial and to advise all participants of any possible bias, prejudice or partiality. 3. Declaring Impasse: The Mediator may determine at any time during the mediation conference that an impasse exists and that the conference should end. 4. Reporting Results of Conference. The Mediator shall submit a written report to the County and the other parties within 10 days of the conference stating whether or not the parties reached an agreement. The Mediator’s report shall indicate the absence of any party from the mediated settlement conference without permission or good cause. 5. Scheduling and Holding the Conference. It is the duty of the Mediator to schedule the conference and conduct it prior to the deadline of completion set by the rules. The Mediator shall strictly observe deadlines for completion of the conference unless said time limit is changed by agreement of the parties. RULE 6. COMPENSATION OF THE MEDIATOR The parties shall compensate the Mediator for mediation services at the rate proposed by the Mediator and agreed to by the parties at the time the Mediator is selected. RULE 7. RULE MAKING These Rules may be amended by the County at any time. Amendments will not affect mediations where claims and/or requests for mediation have been filed at the time the amendment takes effect. RULE 8. DEFINITIONS A. “County” shall mean Orange County North Carolina. B. “Project Designer” is that person or firm stipulated as project designer in the Contract Documents for the project. C. “Claim” is a demand or assertion by a party seeking adjustment or interpretation of Contract terms, payment of money, extension of time or other relief with respect to the terms of the Contract. The term “Claim” also includes other disputes and matters in question between the parties to a Contract involved in the County’s building construction renovation and repair projects arising out of or relating to the Contract or the construction process. Claims must be initiated by a written notice. The responsibility to substantiate Claims shall rest with the party making the Claim. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Revised 11/19 D. “Good Cause” generally includes any circumstance beyond the control of a party, which prevents that party from meeting obligations. When good cause is asserted as an excuse for a party’s failure to appear at a mediation conference or to otherwise comply with the requirements of these Rules, the Mediator, in his or her sole discretion, will determine whether good cause exists to excuse the party’s failure to appear or otherwise comply with these rules. RULE 9. TIME LIMITS A. Any time limit provided for by these Rules may be waived or extended at the sole discretion of the County, if no Mediator has been selected, and at the discretion of the County with concurrence of the Mediator if a Mediator has been selected. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 HOT WORK PERMIT PROGRAM COMPLIANCE WITH THIS PUBLICATION IS MANDATORY OFFICE OF PRIMARY RESPONSIBILITY This instruction establishes policy and procedures and assigns responsibilities and requirements to ensure a comprehensive policy and program exists to perform work during new construction, repair, renovations and/or alterations that require hot work. It applies to all Orange County employees, contractors, and tenants on Orange County premises. Violations of this policy may result in appropriate disciplinary action to include administrative actions such as written or criminal prosecution under applicable North Carolina State Statue. 1. Objective. To assess the risk associated with hot work and prevent loss by fire. 2. Definitions 2.1. Hot Work: Hot Work is defined as any temporary or permanent operation that produces flames, sparks or heat. Hot work is not necessarily an occasional occurrence; it is often conducted as part of production processes in normal manufacturing operations. This includes, but is not limited to: cutting, grinding, brazing, welding, sawing, soldering, thawing pipes, sweating pipes or applying roofing materials with torches and sealing plastic shrink wrap. 2.2. Hot Work Shop: Any work shop that does hot work as part of its normal duties. Hot Work Shops will be inspected by the Orange County Fire Marshal annually and the shop will be given a "Hot Work Permit" for one year. 2.3. Hot Work Sites: Immediate area where hot work is to be accomplished. Includes all areas adjacent (includes above, below, and next to work site) to, on opposite side of wall surfaces, and an area encompassing a Thirty-five foot (35 ft.) radius around the immediate area where hot work is to be performed. 2.4. Hot Work Permit Form: A Hot Work Permit is a three-part form issued for all hot work. The Hot Work Permit Form may be obtained from project managers with Asset Management & Solid Waste Management and will be the only recognized form for use. 2.5. Non-Permissible Areas 2.5.1. See NFPA 51B:5.3 2.5.1.1. Hot Work Shall not be permitted in the following areas: 2.5.1.1.1. In areas not authorized by management 2.5.1.1.2. In sprinklered buildings where sprinklers are impaired, unless the requirements of NFPA 25, et al, are met. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 2.5.1.1.3. In the presence of explosive atmospheres (i.e. where mixtures of flammable gases, vapors, liquids, or dust with air exists) 2.5.1.1.4. In the presence of unclear or improperly prepared equipment, drums, tanks, or other containers that previously contained materials that could develop explosive atmospheres 2.5.1.1.5. In areas with an accumulation of combustible dusts that could develop explosive atmospheres. 2.5.2. Devices: Devices refer to any smoke detector, heat detector, duct smoke detector, beam detector or any other fire alarm system detection device that might require deactivation during hot work. (Manual fire alarm pull stations will not be deactivated during hot work.) 2.5.3. Device Number(s): 2.5.4. Addressable Fire Alarm Systems: Device Number refers to the individual number assigned to each detection device that might be impacted by Hot Work. 2.5.5. Conventional Hard Wired Systems: detection devices are not given an individual number; the Fire Zone along with room locations should be utilized. 2.6. Fire Safety Supervisor: Is responsible for enforcing the hot work policy, activities of fire watch and all outside contractors. 2.6.1 First and foremost, he or she has to decide if there is a safer way to complete the job or if hot work is the only option. 2.6.2 If hot work is the only option, determine if hot work can be performed in the area identified. Hot work must be prohibited in any area where the hazard cannot be eliminated or controlled. “No hot work” signs should be clearly posted. 2.6.3 If there is no alternative to hot work and the area in question is fire-safe, the fire safety supervisor authorizes the hot work by issuing FM Global’s Hot Work Permit. The job is then discussed with the person performing fire watch and hot work operator after following the precautions identified on the permit. 2.6.4 Oversees and manages the activities of the fire watch and outside contractors, providing approval signatures as required on the permit. 2.6.5 Once a decision has been made to use the hot work permit form, the fire safety supervisor shall work with the contractor performing hot work to complete Part 1 and issue the permit. The second page shall be taken out, scanned and electronically sent to Orange County Fire Marshal’s Office. The copy shall be retained with project management. The risk manager shall be notified of any hot work in Orange County facilities by email and telephone. 919-245-2155. acornetto@orangecountync.gov 2.7 Fire Watch: The job of the fire watch is to prevent fire and be ready to respond if one starts with the following duties: Stays near the person performing the hot work Closes all fire doors Makes sure the work area remains free of combustibles and tarpaulins are not moved DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Pays particular attention to hot work jobs at elevated locations, on the building roof, on walls or inside buildings with multiple floors; these areas often are not watched carefully enough and frequently have ignited from stray sparks smoldering long after workers have left the job site Never leaves the area while work is in progress or during breaks, such as lunch, unless relieved by a qualified replacement Stops the hot work if improper conditions develop Is ready to sound the alarm and use an ext inguisher or fire hose if a fire starts After completion of the Hot Work, a selected trained individual with an appropriate fire extinguisher provided by the contractor doing work must remain in the immediate area of the Hot Work to ensure that a fire does not start. Fire Watch must be maintained constant for 1 hour after the completion of hot work and every half-hour for the additional 3 hours. If smoldering is detected the Fire Watch will follow the RACE procedures: R Remove persons from danger A Activate the fire alarm system C Close all windows and doors E Extinguish the fire or evacuate the area. 3 Procedures 3.6 Supervisors, Project Managers, and Contractors will determine if welding, cutting, soldering and/ or heating is absolutely necessary as part of the project or work order and there are no alternative options to complete the job. If hot work is required, it will be the responsibility of the supervisor, project manager, or contractor to determine if the work can be performed outside the facility. Hot Work conducted outside still requires a permit be obtained. If outside, maintain a minimum of 35ft away from any structure or other combustible. If hot work cannot be completed outside the facility, a Hot Work Permit is required and will be completed in accordance with the procedures in Part 1 of the hot work permit. 3.7 Regardless of completing the work outside or inside the facility, the general fire safety guidelines outlined in this section shall be followed. 3.8 Permit Issue: Hot Work Permits can be issued by Asset Management project manager or designee. Hot Work Permits shall be requested at least 24 hours or last working day in advance of needed work. 3.9 Individuals issuing Hot Work Permits will ensure that: 3.9.1 Hot work site is acceptable for Hot Work and that there are no excessive combustibles or combustible/flammable liquids in the hot work area; 3.9.2 Individual(s) performing the Hot Work understand the minimum safety precautions as outline on the Hot Work Permit by completing the appropriate blocks on the form; DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 3.9.3 A copy of the Hot Work Permit is forwarded to the Orange County Fire Marshal Division prior to starting any hot work; unless it is deemed “emergency work”, but still must be approved by Asset Management Project Manager. 3.9.4 Original copy of the Hot Work Permit is posted in the hot work area in clear view; 3.9.5 If a Fire Watch is required that the appropriate information is completed on the Hot Work Permit Form. 3.9.6 Hot Work Permits are issued on a day-to-day basis, with the exception of designated “Hot Work Zones”. Hot Work Zones are approved by the Orange County Fire Marshal Division after a site visit, and are typically granted for long-term projects only. A “Hot Work Zone” permit may be issued for work requiring daily hot work over a lengthy period of time. 4 Notification: 4.6 It is the responsibility of the individual performing the Hot Work to ensure that Asset Management notifies the appropriate fire alarm monitoring company, Orange County’s insurance carrier through the risk manager and the Orange County Fire Marshal Division to the initiation and upon completion of any Hot Work. 5 Enforcement: 5.6 Orange County Fire Marshal Division has the responsibility to spot check hot work permits to ensure compliance. Permits may be revoked if the safety precautions have been violated. 5.7 The Asset Management Department has the responsibility to ensure only trained and certified personnel complete the Hot Work permit and that only qualified individuals perform Hot Work. 5.8 A designated Hot Work Supervisor must be onsite during all Hot Work Operations 6 Training: 6.6 All Orange County personnel that issue, spot check or perform hot work shall complete online annual training and obtain certification. All contractors that perform hot work shall complete online annual training. No individual may complete a Hot Work Permit or perform hot work without this certification. Asset Management will maintain all records of training completion. Go to https://fmglobaltraining.skillport.com/skillportfe/custom/login/fmglobal/fmgloballogin.a ction?path=fmglobal/login/FmglobalLoginAction&lang=en for access to the program. Once logged in the FM Global’s Client Training Center, type hot work in the Search bar and press Search. Take the Managing Hot Work Using FM Global’ s Hot Work Permit System and How To Fill Out A Hot Work Permit. A copy of your certificate shall be submitted to Asset Management. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 7 Coordination and Approval 7.6 Any requested changes to this policy will be coordinated with Asset Management, Risk Management and the Orange County Fire Marshal prior to the change being implemented 7.7 All departments annotated below have coordinated and given their approval via signature to this Hot Work Program Operating Instruction 7.8 Asset Management Project Managers or are to sign with their approval, the Hot Work Permit, indicating that the site has been inspected for safety prior t o work, as instructed on the Hot Work Form, and that a Fire Watch will be maintained by trained personnel or approved methods (i.e. detection systems in working order). The signee assumes responsibility for the work site and workers. DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 6800$5<2):25. 3$57 *(1(5$/ *(1(5$/'(6&5,37,212):25.,1&/8'(' $ )XUQLVKODERUHTXLSPHQWPDWHULDOVVHUYLFHVDQGVXSHUYLVLRQQHFHVVDU\WRFRPSOHWHWKHZRUN RXWOLQHGLQWKHVHWHFKQLFDOVSHFLILFDWLRQVDQGGUDZLQJVIRUURRIUHSODFHPHQWDQGDVVRFLDWHGZRUN DWWKH0DLQ%XLOGLQJRIWKH2UDQJH&RXQW\6SRUWVSOH[ORFDWHGDW0HDGRZODQGV'ULYHLQ +LOOVERURXJK1RUWK&DUROLQD % 7KHIROORZLQJLVDVXPPDU\RIURRIUHSODFHPHQWZRUNLWHPVLQFOXGHG7KLVVXPPDU\LVQRW LQWHQGHGWREHDQDOOLQFOXVLYHVFRSHRIZRUN5HIHUWRLQGLYLGXDOVSHFLILFDWLRQVHFWLRQVDQG GUDZLQJVIRUPRUHVSHFLILFSURMHFWUHTXLUHPHQWV 3HUIRUPD3UH-RE'DPDJH6XUYH\SULRUWRWKHVWDUWRIZRUN7KHSXUSRVHRIWKHVXUYH\LV WRGRFXPHQWH[LVWLQJFRQGLWLRQVDQGLGHQWLI\H[LVWLQJGDPDJHVGLVWUHVVHV6XUYH\PXVW LQFOXGH URRIWRS FRPSRQHQWV EXLOGLQJ H[WHULRU VLWH IHDWXUHV SDYHPHQWV ZDONZD\V ODQGVFDSLQJ HWF EXLOGLQJ LQWHULRU DSSOLFDEOH HTXLSPHQW DQG RWKHU DSSOLFDEOH FRPSRQHQWV$SUHMREGDPDJHVXUYH\LVFRQVLGHUHGWREHDSURWHFWLRQIRUWKHFRQWUDFWRU DQG GRFXPHQWDWLRQ ZLOO EH XVHG WR DVVLVW WKH 2ZQHU 'HVLJQHU DQG &RQWUDFWRU LQ GHWHUPLQLQJ ZKHWKHU GDPDJHV QRWHG GXULQJ FRQVWUXFWLRQ ZHUH FDXVHG E\ FRQVWUXFWLRQ DFWLYLWLHVRUZHUHH[LVWLQJ 5HPRYHWKHH[LVWLQJPHPEUDQHVLQVXODWLRQIODVKLQJHWFGRZQWRWKHJ\SVXPERDUGRQ 5RRI$UHD$DQGGRZQWRWKHPHWDOGHFNRQ5RRI$UHD%DQGOHJDOO\GLVSRVHRIRIIVLWH 'RQRWXVHSRZHUEORZHUVWRUHPRYHGHEULVIURPWKHIOXWHVRIWKHPHWDOGHFNXVHEURRPV DQGYDFXXPFOHDQHUV5HPRYHWKHDEDQGRQHGSHQHWUDWLRQVDWWKHORFDWLRQVVKRZQRQWKH GUDZLQJVDQGUHSDLUWKHGHFN3HUIRUPDPLQLPXPRIIDVWHQHUSXOOWHVWVSULRUWR EHJLQQLQJFRQVWUXFWLRQLQWKHSUHVHQFHRIWKH(QJLQHHUDQGRU2ZQHU¶VUHSUHVHQWDWLYH 5HPRYHH[LVWLQJFRSLQJFRXQWHUIODVKLQJDQGRWKHUURRIDFFHVVRULHVDQGGLVSRVHRIRII VLWH,QVSHFWH[LVWLQJQDLOHUVLGHQWLILHGWRUHPDLQDQGUHSODFHGDPDJHGGHWHULRUDWHGQDLOHUV 7KHH[LVWLQJURRIV\VWHPFRQVLVWVRIWKHIROORZLQJ 5RRI$UHD$$SSUR[LPDWHO\6) %DOODVWHG(3'0PHPEUDQH 3RO\LVRF\DQXUDWHLQVXODWLRQ±$SSUR[LPDWHO\Ǝ 7DSHUHGLQVXODWLRQDWFULFNHWVDQGVDGGOHV *\SVXPERDUG±$SSUR[LPDWHO\Ǝ 0HWDOGHFN 5RRI$UHD%$SSUR[LPDWHO\6) %DOODVWHG(3'0PHPEUDQH :RRGILEHUERDUGLQVXODWLRQ±$SSUR[LPDWHO\Ǝ *\SVXPERDUG±$SSUR[LPDWHO\Ǝ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 0HWDOGHFN 1RWH6ORSHLVLQWKHGHFNRQERWKURRIDUHDV 7HVWDOOGUDLQVXQGHUJURXQGGUDLQDJHIRUIUHHIORZSULRUWREHJLQQLQJRIZRUN&ORJJHGRU EORFNHGGUDLQVSLSHVVKDOOEHUHSRUWHGWRWKH2ZQHU $GMXVWWKHGUDLQKHLJKWVDQGDGGH[WHQVLRQVDVQHFHVVDU\WRSURYLGHSURSHULQVWDOODWLRQRI WKHQHZURRIV\VWHP$GGH[WHQVLRQVWRRYHUIORZGUDLQVVRWKHFODPSLQJULQJLVIOXVKZLWK WKHLQVXODWLRQ'RQRWVXPSRUVKDYHLQVXODWLRQDURXQGRYHUIORZGUDLQ 5HSODFHDQ\GDPDJHGJ\SVXPERDUGRQ5RRI$UHD$,QVSHFWWKHH[LVWLQJPHWDOGHFNLQ WKHVH DUHDV DQG UHVWRUHUHSODFH FRUURGHG PHWDO GHFN 1RWLI\ 'HVLJQHU RI DQ\ DUHDV UHTXLULQJUHSODFHPHQW ,QVSHFWWKHH[LVWLQJPHWDOGHFNDQGUHVWRUHUHSODFHFRUURGHGPHWDOGHFNRQ5RRI$UHD% 1RWLI\'HVLJQHURIDQ\DUHDVUHTXLULQJUHSODFHPHQW ,QVSHFWH[LVWLQJZRRGEORFNLQJDQGSO\ZRRGDQGUHSODFHDWORFDWLRQVZKHUHH[LVWLQJ PDWHULDOVDUHGDPDJHGGHWHULRUDWHGZDUSHGRUGRQRWPHHWWKHVSHFLILHGUHTXLUHPHQWV 9HULI\DQ\ZRRGEORFNLQJWRUHPDLQLVSURSHUO\VHFXUHGWRWKHH[LVWLQJVWUXFWXUH3URYLGH VXSSOHPHQWDOIDVWHQHUVLIQRWHGRQWKHGUDZLQJV5HPRYHQDLOHUDWGULSHGJHRI5RRI$UHD %DQGLQVWDOOQHZQDLOHU 5DLVHSHQHWUDWLRQVWRILQLVKDPLQLPXPRIƎDERYHWKHILQLVKHGURRIVXUIDFH$Q\IODVKLQJ KHLJKWVOHVVWKDQƎZLOOKDYHWREHDSSURYHGE\WKH'HVLJQHUDQGPDQXIDFWXUHULQZULWLQJ 5DLVHJDVZDWHUSLSHVDQGJDVOLQHWUDSVWRDFFRPPRGDWHWKLFNQHVVRIWKHQHZURRIV\VWHP DWWKHORFDWLRQVVKRZQRQWKHGUDZLQJ 1RWLI\WKH'HVLJQHUSULRUWREHJLQQLQJLQVWDOODWLRQRIWKHQHZURRIV\VWHPRQHDFKDUHD 3URYLGHDQGLQVWDOODPHFKDQLFDOO\IDVWHQHGEDVHOD\HURISRO\LVRF\DQXUDWHLQVXODWLRQ RYHUWKHJ\SVXPERDUGRQ5RRI$UHD$3URYLGHDQGLQVWDOOKLJKGHQVLW\FRPSRVLWH SRO\LVRF\DQXUDWHLQVXODWLRQXVLQJWKHVSHFLILHGDGKHVLYHVRYHUWKHEDVHOD\HURQ5RRI$UHD $&RPSRVLWHERDUGWREHDWRWDORIWKLFNIRU5RRI$UHD$7KHEXLOGLQJLVQRW)0 LQVXUHGEXWIDVWHQLQJDQGDGKHVLRQSDWWHUQVDUHWREHFRPSDUDEOHZLWKWKHZLQGXSOLIW UHVLVWDQFHSURYLGHGE\D)0FODVVLILFDWLRQDQGPHHW1&%XLOGLQJ&RGH7RWDO LQVXODWLRQDQGFRYHUERDUGWKLFNQHVVDWWKHHGJHRIWKHGUDLQVFXSSHUVXPSVRQ5RRI$UHD $VKDOOEH´6WDJJHUDOOMRLQWV1LJKWWLHLQORFDWLRQVVKDOOEHVDZWRRWKHGDQG³ILOOLQ´ FRXUVHVWKDWFDQEHUHPRYHGZKHQVXEVHTXHQWZRUNEHJLQV/RFDWHDQ\FRQGXLWEHQHDWK WKHGHFNWRDYRLGGDPDJHE\IDVWHQHUV 3URYLGHDQGLQVWDOOKLJKGHQVLW\FRPSRVLWHSRO\LVRF\DQXUDWHLQVXODWLRQRQ5RRI$UHD% WRWDO´WKLFN0HFKDQLFDOO\IDVWHQLQWRWKHPHWDOGHFNWRPHHW)0ZLQGXSOLIW UHTXLUHPHQWVRYHUWKHILHOGRIWKHURRIZLWKDVVRFLDWHGLQFUHDVHVLQWKHVHFXUHPHQWIRUWKH URRISHULPHWHUVDQGFRUQHUV7KHEXLOGLQJLVQRW)0LQVXUHGEXWIDVWHQLQJSDWWHUQVDUHWR DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW EHFRPSDUDEOHZLWKWKHZLQGXSOLIWUHVLVWDQFHSURYLGHGE\D)0FODVVLILFDWLRQDQG PHHWWKH1&%XLOGLQJFRGH 3URYLGHDQGLQVWDOOWDSHUHGFULFNHWVVDGGOHVEHWZHHQWKHGUDLQVDQGRYHUOD\ZLWKKLJK GHQVLW\SRO\LVRF\DQXUDWHXVLQJWKHVSHFLILHGDGKHVLYH 3URYLGHDQGLQVWDOODIXOO\DGKHUHGWKHUPRSODVWLFURRIPHPEUDQHDQGPHPEUDQHIODVKLQJ V\VWHPVZLWKKHDWZHOGHGVHDPVRQDOODUHDV8VHDGHVLJQDWHGJHQHUDWRUIRUKHDWZHOGLQJ URERWWKDWZHOGVWKHVHDPV3URYLGHDQGLQVWDOORWKHUDVVRFLDWHGV\VWHPFRPSRQHQWVDV GHWDLOHGRUDVUHTXLUHGE\WKHV\VWHPPDQXIDFWXUHU1HZURRIV\VWHPPXVWPHHWWKH UHTXLUHPHQWVIRU8/&ODVV$ILUHFODVVLILFDWLRQDQGZLQGXSOLIWUHVLVWDQFHLQDFFRUGDQFH ZLWKWKHVHVSHFLILFDWLRQVWKH1RUWK&DUROLQD6WDWH%XLOGLQJ&RGHDQG$6&(ODWHVW HGLWLRQ $Q\ DGGLWLRQDO PDQXIDFWXUHU UHTXLUHPHQWVHQKDQFHPHQWVH[SHULPHWHU VHFXUHPHQWSHHOVWRSVSO\ZRRGRQWKHZDOOVHWFVKDOOEHLQFOXGHGLQWKHFRQWUDFWRU¶V ELG 3URYLGHPHFKDQLFDOHOHFWULFDOSOXPELQJDQGRWKHUVHUYLFHVDVQHHGHGWRDFFRPSOLVK GLVFRQQHFWLRQUHFRQQHFWLRQPRGLILFDWLRQUHFKDUJLQJRUH[WHQVLRQRIXWLOLW\RUFRQWURO VHUYLFHV LQFOXGLQJ GXFWZRUN DW DQ\ URRIPRXQWHG HTXLSPHQW DVVRFLDWHG ZLWK OLIWLQJUDLVLQJRUPRGLI\LQJWRDFFHSWWKHQHZURRIV\VWHP&RRUGLQDWHZLWKWKHIDFLOLW\ PDLQWHQDQFHVWDIIWRVFKHGXOHWHPSRUDU\VKXWGRZQRIWKHXQLWVDQGWRSUHYHQWGDPDJHWR WKHXQLWV8SRQFRPSOHWLRQRIZRUNFRQILUPSURSHUZRUNLQJRUGHUZLWKWKH2ZQHU 3URYLGHDQGLQVWDOOPHPEUDQHIODVKLQJVDWURRISHULPHWHUVDQGSHQHWUDWLRQV6XSSOHPHQWDO VHFXUHPHQWZLOOEHUHTXLUHGRQZDOOVWDOOHUWKDQ´ ,QVWDOO WKHUPRSODVWLF PHPEUDQH FODGPHWDO IODVKLQJ SUHILQLVKHG VKHHWPHWDO IODVKLQJV FRXQWHUIODVKLQJVDQGDFFHVVRULHVWRFRPSOHWHZDWHUWLJKWGHWDLOLQJDWSHULPHWHUHGJHDQG SHQHWUDWLRQV3ODFHZDONWUHDGEHQHDWKDOOVXUIDFHPRXQWHGVOHHSHUVURRIKDWFKDQGODGGHU ORFDWLRQVDQGDWDQ\RWKHUORFDWLRQVVKRZQRQWKHGUDZLQJV &OHDQDQGSUHSDUHH[LVWLQJGUDLQFRPSRQHQWVWRDFFHSWQHZURRIPDWHULDOV5HSODFHSODVWLF VWUDLQHUV RU RWKHU FRPSRQHQWV ZLWK FDVW LURQ WRPDWFK VL]HVW\OH 5HSODFH H[LVWLQJ ´ RYHUIORZGUDLQFODPSLQJULQJVZLWK´FODPSLQJULQJV&OHDQSULPHDQGSDLQWFODPSLQJ ULQJDQGVWUDLQHU 3LSHH[LVWLQJRYHUIORZGUDLQZKHUHQRWHGVRWKDWLWGLVFKDUJHVRXWWKHVLGHRIWKHEXLOGLQJ DWWKHORFDWLRQVKRZQRQWKHGUDZLQJ ,QVWDOOQHZIDOOSURWHFWLRQDQFKRUVDWWKHORFDWLRQVVKRZQRQWKHGUDZLQJV 5HSODFHDOOSLSHVXSSRUWV0D[LPXPVSDFLQJRIIHHWDQGRQHVXSSRUWRQHLWKHUVLGHRI WXUQ,QVWDOOVOLSVKHHWVXQGHUDOOSLSHVXSSRUWV 3DLQWWKHXQGHUVLGHRIWKHGHFNDW5RRI$UHD% :LGHQWKHH[LVWLQJSULPDU\VFXSSHUVIURP´ZLGHWR´ZLGHDWWKHORFDWLRQVVKRZQRQ WKHGUDZLQJV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ,QVWDOOQHZ´[´RYHUIORZVFXSSHUVDWWKHORFDWLRQVVKRZQRQWKHGUDZLQJV 3URYLGHDQGLQVWDOOQHZURRIKDWFKUDLO 3URYLGHDQGLQVWDOOUXEEHUSDYHUVDWORFDWLRQVDURXQGHTXLSPHQWDVGLUHFWHGE\WKH2ZQHU $EDVHELGTXDQWLW\LVVKRZQLQ6HFWLRQ 3URYLGHDQGLQVWDOOQHZQRQSHQHWUDWLQJKDQGUDLODWWKHORFDWLRQVKRZQRQWKHGUDZLQJ 3UHSDUHDQGSDLQWWKHHTXLSPHQWVXSSRUWVDWWKHORFDWLRQVVKRZQRQWKHGUDZLQJ$OWHUQDWH %LG 5HSODFHWKHSLSHLQVXODWLRQDWWKHORFDWLRQVVKRZQRQWKHGUDZLQJ$OWHUQDWH%LG3LSH LQVXODWLRQLVWRPDWFKH[LVWLQJ 3UHSDUHDQGSDLQWWKHH[LVWLQJQDWXUDOJDVOLQHVRQ5RRI$UHD$$OWHUQDWH%LG3UHSDUH SLSHVLQDFFRUGDQFHZLWKORFDOEXLOGLQJFRGHDQGJDVFRPSDQ\UHFRPPHQGDWLRQV 3URYLGH DQG LQVWDOO RYHUKHDG SURWHFWLRQ DW WKH HQWUDQFHH[LW ORFDWLRQV VKRZQ RQ WKH GUDZLQJ 3URYLGH DQG LQVWDOO RWKHU DFFHVVRU\ RU LQFLGHQWDO FRPSRQHQWV RU PRGLI\ RWKHU URRI IHDWXUHVLWHPVQRWVSHFLILFDOO\OLVWHGRUVKRZQRQGUDZLQJVEXWUHTXLUHGIRUWKHFRPSOHWH DQGSURSHULQVWDOODWLRQRIWKHQHZURRIV\VWHP 1RWH 3URYLGHFRQVWUXFWLRQIHQFLQJLQVWDOOHGDURXQGWKHSHULPHWHURIWKHSURMHFWVWDJLQJDQGVWRUDJH OLPLWVDVGHILQHGRQWKHVLWHSODQ7KHIHQFHVKDOOEHFRQVWUXFWHGRIKHDY\GXW\FKDLQOLQN PDWHULDOVKDYHDPLQLPXPKHLJKWRIVL[IHHWDQGVKDOOKDYHDFRQWLQXRXVWRSWXEXODUUDLO7KH IHQFLQJPXVWXVHQRQSHQHWUDWLQJSRVWVVHWLQZHLJKWHGEDVHV6ZLQJJDWHVVKDOOEHLQFOXGHG DWHYHU\DFFHVVWRWKHHQFORVHGDUHD:KHQWKHSURMHFWLVFRPSOHWHIHQFLQJPXVWEHUHPRYHG DQGJURXQGFRQWRXUVUHVWRUHGWRRULJLQDOFRQGLWLRQ 'HOLYHULHVDUHPDGHWRWKHSRROORDGLQJGRFNDFRXSOHRIWLPHVDZHHN0DLQWDLQDFFHVVWRWKH ORDGLQJGRFNDQGFRRUGLQDWHGHOLYHULHVZLWK2UDQJH&RXQW\ $ILUHZDWFKLVUHTXLUHGIRUDOOKRWZRUNLQFOXGLQJKHDWZHOGLQJRIVHDPV $ZRUNHUPXVWEHRQWKHJURXQGGLUHFWLQJSHGHVWULDQVZKLOHZRUNLQJRQRUQHDU5RRI$UHD% 3URYLGHRYHUKHDGSURWHFWLRQIRUWKHJHQHUDWRUDQGHOHFWULFDOSDQHOZLWKLQVWDJLQJDUHD 3URYLGHD&29,'SODQIRUUHYLHZDQGDSSURYDOSULRUWREHJLQQLQJZRUN $KRWZRUNSHUPLWZLOOEHUHTXLUHGDQGWKHFRQWUDFWRUPXVWIROORZDOOSHUPLWUHTXLUHPHQWV 7KHZRUNHUVPD\QRWKDYHFRQWDFWZLWKWKHEXLOGLQJRFFXSDQWV&HOOSKRQHVRUZD\UDGLRV DUHWREHXVHGWRFRPPXQLFDWHIURPWKHURRIWRWKHVWDJLQJDUHDJURXQG 1RRIIHQVLYHGHFDOVORJRVDUHWREHZRUQRQFORWKLQJRUVKRZQRQYHKLFOHV 7KHXVHRIWREDFFRSURGXFWVDUHQRWDOORZHGRQWKHFDPSXV $ PLQLPXP RI WKUHH VLWH YLVLWV DQG D ILQDO LQVSHFWLRQ DUH UHTXLUHG E\ WKH URRI V\VWHP PDQXIDFWXUHU1RWLI\'HVLJQHUDQG2ZQHUDPLQLPXPRIKRXUVEHIRUHPDQXIDFWXUHU¶VYLVLW &RQWUDFWRU VKDOO SURYLGH D IRUHPDQ RU D UHSUHVHQWDWLYH IURP WKH &RQWUDFWRU WKDW LV LQ D VXSHUYLVRU\SRVLWLRQWKDWLVIDPLOLDUZLWKWKHLQVWDOODWLRQRIWKHQHZURRIV\VWHPDQGZKRZLOO EHRQWKHVLWHDQ\WLPHWKDWZRUNE\WKH&RQWUDFWRURURQHRIKLV6XEFRQWUDFWRUVLVLQSURJUHVV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 7KH&RQWUDFWRUPXVWSURYLGHDUHSUHVHQWDWLYHWKDWLVIOXHQWLQ(QJOLVKRQVLWHDWDOOWLPHVZKHQ ZRUNLVLQSURJUHVVWRHQVXUHWKDWWKH2ZQHUDQG'HVLJQHUFDQFRPPXQLFDWHZLWKWKHFUHZ PHPEHUVDVQHHGHGGXULQJFRQVWUXFWLRQ %7KHWHFKQLFDOVSHFLILFDWLRQVDQGGUDZLQJVSURYLGHGDUHIRUFRPPXQLFDWLQJGHVLJQLQWHQW,WLVWKH UHVSRQVLELOLW\RIWKH&RQWUDFWRUWRH[DPLQHWKHWHFKQLFDOVSHFLILFDWLRQVDQGGUDZLQJVDQGWKHVLWH DQGEHFRPHIDPLOLDUZLWKDQGYHULI\WKHH[LVWLQJFRQGLWLRQVVSHFLILHGGHVLJQLQWHQWDQGRWKHU FRQGLWLRQVQHFHVVDU\IRUDQDFFXUDWHSURSRVDODQGH[HFXWLRQRIWKHZRUN$Q\GLVFUHSDQFLHV GLVFRYHUHGVKRXOGEHEURXJKWWRWKHDWWHQWLRQRIWKH'HVLJQHUIRUFODULILFDWLRQRUFRUUHFWLRQ &225',1$7,21$1'&2175$&72586(2)35(0,6(6 $7KH2ZQHUZLOORFFXS\WKHSUHPLVHVGXULQJWKHSHULRGRIFRQVWUXFWLRQIRUWKHFRQGXFWRIQRUPDO RSHUDWLRQV/LPLWWKHXVHRIWKHSUHPLVHVIRUFRQVWUXFWLRQRSHUDWLRQVWRDOORZIRU2ZQHURFFXSDQF\ WRWKHEXLOGLQJDQGDGMDFHQWEXLOGLQJVWKURXJKWKHGXUDWLRQRIWKHSURMHFW&RQWUDFWRUVKDOOVFKHGXOH DQGFRRUGLQDWHZRUNZLWKWKHGHVLJQDWHGSRLQWVRIFRQWDFWDW2UDQJH&RXQW\$VVHW0DQDJHPHQW DQGZLWKLQWKHEXLOGLQJ %)RUWKHSXUSRVHRIELGGLQJDFFHSWDEOHZRUNKRXUVVKDOOEH0RQGD\)ULGD\EHWZHHQDPDQG SP7KH2UDQJH&RXQW\3URMHFW0DQDJHUPXVWEHQRWLILHGLQDGYDQFHRIZRUNRQZHHNHQGV RURXWVLGHRIWKHKRXUVOLVWHGDERYHWRDOORZIRUFRRUGLQDWLRQDQGDSSURYDO7KLVDQWLFLSDWHG VFKHGXOHLVSURYLGHGIRUJHQHUDOSODQQLQJDQGGRHVQRWHOLPLQDWHWKHUHTXLUHPHQWIRUWKH&RQWUDFWRU WRFRRUGLQDWHZLWKWKH2ZQHUWROLPLWGLVUXSWLRQWRSRWHQWLDOLQWHULRUIXQFWLRQVXVH &7KH&RQWUDFWRUPXVWIROORZDOOUHTXLUHPHQWVRI2UDQJH&RXQW\LQFOXGLQJEXWQRWOLPLWHGWRXVH RIVWDJLQJDQGVWRUDJHDUHDVDVGHVLJQDWHGE\WKHSURMHFWGRFXPHQWVHQWUDQFHWRWKHVLWHE\ZRUNHUV DQG GHOLYHU\ YHKLFOHV FRRUGLQDWLRQ WR DYRLG VLJQLILFDQW QRLVHGLVUXSWLRQ DQG FRRUGLQDWLRQ RI FRQVWUXFWLRQVFKHGXOLQJDURXQGWKHHYHQWVRIWKHEXLOGLQJ&RQWUDFWRUVKDOOQRWSHUIRUPZRUNLI UHTXHVWHGE\WKH2ZQHUGXHWRVSHFLDOHYHQWVDWWKHEXLOGLQJ&RQWUDFWRUVKDOOUHFHLYHDGGLWLRQDO FRQWUDFWWLPHIRUWLPHQRWSHUPLWWHGWRZRUNEXWVKDOOQRWUHFHLYHDGGLWLRQDOFRPSHQVDWLRQ ''RQRWSHUPDQHQWO\EORFNLQJUHVVDQGHJUHVVIURPWKHEXLOGLQJ0DLQWDLQDFFHVVWKDWGRHVQRW LQWHUIHUHZLWKWKH2ZQHU¶VYHKLFXODURUSHGHVWULDQWUDIILFXQOHVVFRRUGLQDWHGZLWKWKH2ZQHU :KHUHYHKLFXODURUSHGHVWULDQWUDIILFZLOOEHUHURXWHGRUWHPSRUDULO\EORFNHGSURYLGHSURWHFWLYH IHQFLQJ DQGVLJQDJH WR VDIHO\ UHGLUHFW WUDIILF DV QHHGHG 3URYLGH HLWKHU FRYHUHG ZDONZD\V WR PDLQWDLQVDIHDFFHVVDWHQWUDQFHH[LWVIURPWKHEXLOGLQJRUXWLOL]HGDVSRWWHURQWKHJURXQGZKHUH RYHUKHDGZRUNPD\RFFXU ( 8WLOLWLHVDUHWRUHPDLQXQGLVWXUEHGDQGLQFRQWLQXRXVRSHUDWLRQRUSURYLGHDOWHUQDWHRUWHPSRUDU\ VHUYLFHVDFFHSWDEOHWRWKH2ZQHU7HUPLQDWHQRXWLOLW\HYHQIRUDVKRUWSHULRGZLWKRXWWKHSULRU DSSURYDOIURPWKH2ZQHU7KH&RQWUDFWRULVUHVSRQVLEOHIRUWKHORFDWLRQDQGSURWHFWLRQRIH[LVWLQJ XWLOLWLHVIURPGDPDJHGXHWRFRQVWUXFWLRQ5HSDLUVUHTXLUHGGXHWRGDPDJHVWRRURXWDJHRIH[LVWLQJ XWLOLWLHVPXVWEHLPPHGLDWHO\FRRUGLQDWHGDQGSDLGIRUE\WKHFRQWUDFWRU:KHUHUHTXHVWHGE\WKH 2ZQHUWKH&RQWUDFWRUPXVWPDLQWDLQDPLQLPXP¶FOHDUDQFHIURPVSHFLILFHTXLSPHQWRUXWLOLWLHV WKDWPD\UHTXLUH2ZQHUDFFHVV ) 3DUNLQJDQGDFFHVVWRWKHVLWHPXVWEHFRRUGLQDWHGZLWKWKH2ZQHU¶VUHSUHVHQWDWLYH'HVLJQDWHG OLPLWVIRUGHOLYHU\WUXFNVDQGRWKHUSDUNLQJDVVRFLDWHGZLWKWKHSURMHFWZLOOEHGHILQHGDWWKHSUH FRQVWUXFWLRQFRQIHUHQFH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW * &RQWUDFWRUVKDOOSURYLGHDVXSHULQWHQGHQWIRUHPDQRURWKHUUHSUHVHQWDWLYHIURPWKH&RQWUDFWRUWKDW LVLQDVXSHUYLVRU\SRVLWLRQDQGIOXHQWLQ(QJOLVKZKRZLOOEHRQWKHVLWHDQ\WLPHWKDWZRUNLVLQ SURJUHVV,IZRUNHUVLQVWDOOLQJWKHURRIDUHXQGHUVXEFRQWUDFWDQGDUHQRWGLUHFWHPSOR\HHVRIWKH FRQWUDFWRU D UHSUHVHQWDWLYH RU SHUVRQQHO LQ D VXSHUYLVRU\ SRVLWLRQ 6XSHULQWHQGHQW GLUHFWO\ HPSOR\HGE\WKH3ULPH&RQWUDFWRUPXVWEHSUHVHQWIXOOWLPHDQ\WLPHZRUNLVRFFXUULQJRQVLWH 3(50,76 $ 7KH&RQWUDFWRUVKDOODSSO\IRUVHFXUHDQGSD\IRUDOOSHUPLWVJRYHUQPHQWDOIHHVLQVSHFWLRQVDQG OLFHQVHVQHFHVVDU\IRUWKHSURSHUH[HFXWLRQDQGFRPSOHWLRQRIWKH:RUNZKLFKDUHDSSOLFDEOHDW WKHWLPHWKDW%LGVDUHUHFHLYHG&RQWUDFWRUVKDOOSURYLGHHYLGHQFHRIDFFHSWDQFHRIZRUNE\ VXEPLWWLQJLQVSHFWLRQIRUPVIURPDSSURSULDWHDJHQFLHVLQGLFDWLQJDFFHSWDQFHRIZRUN &2175$&77,0($1'6&+('8/,1* $7KHFRQWUDFWWLPHIURPWKH1RWLFHWR3URFHHGWRSURMHFWDFFHSWDQFHIRU%DVH%LGZRUNLVGD\V 7KH1RWLFHWR3URFHHGGDWHLVDQWLFLSDWHGWREHVHWDVHDUO\DVSRVVLEOHIROORZLQJH[HFXWLRQRI FRQVWUXFWLRQFRQWUDFWV %$6(%,' $ 7KH%DVH%LGLQFOXGHVWKHIROORZLQJVFRSHRIZRUNVKRZQRQWKHGUDZLQJVDQGVSHFLILHGLQWKH 3URMHFW0DQXDO5HSODFHPHQWRIWKHH[LVWLQJURRIV\VWHPVRQ5RRI$UHDV$DQG%DVGHVLJQDWHG RQWKH3URMHFW'UDZLQJV %7KH%DVH%LGVKDOODOVRLQFOXGHWKHHVWLPDWHGTXDQWLWLHVRIZRUNVSHFLILHGLQ6HFWLRQRI WKLV3URMHFW0DQXDO %,'$/7(51$7(6 $ %LG$OWHUQDWH3UHSDUHSULPHDQGSDLQWHTXLSPHQWVXSSRUWDWWKHORFDWLRQVVKRZQRQWKH GUDZLQJV %%LG$OWHUQDWH5HSODFHWKHSLSHLQVXODWLRQDWWKHORFDWLRQVKRZQRQWKHGUDZLQJV &%LG$OWHUQDWH3UHSDUHSULPHDQGSDLQWWKHQDWXUDOJDVOLQHVRQ5RRI$UHD$ 5()(5(1&(67$1'$5'6 $ )RUSURGXFWVVSHFLILHGE\DVVRFLDWLRQRUWUDGHVWDQGDUGVFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKHODWHVW VWDQGDUGH[FHSWZKHQPRUHULJLGUHTXLUHPHQWVDUHVSHFLILHGRUUHTXLUHGE\DSSOLFDEOHFRGHV % ,QVWDOOLWHPVQHFHVVDU\WRHQVXUHFRPSOLDQFHZLWKWKHPRVWUHFHQWDGRSWHGHGLWLRQRIWKH1RUWK &DUROLQD%XLOGLQJ&RGHZKHWKHURUQRWVKRZQRQSURMHFWGUDZLQJVRUVSHFLILFDOO\LQGLFDWHGLQWKH WHFKQLFDOVSHFLILFDWLRQV '(6,*1(5¶66,7(9,6,76 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6800$5<2):25. 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW $ 'HVLJQHU RU VLWH UHSUHVHQWDWLYH ZLOO SHUIRUP SHULRGLF YLVLWV WR WKH VLWH WR REVHUYH &RQWUDFWRU DFWLYLWLHVDQGQRWHQRQFRQIRUPDQFHZLWKWKHVSHFLILFDWLRQVWRWKH2ZQHUDQG&RQWUDFWRU1RQ FRQIRUPDQFHLWHPVPXVWEHFRUUHFWHGE\WKH&RQWUDFWRUSULRUWRDSSURYDORISD\PHQW % &RQWUDFWRUVKDOOFRRSHUDWHZLWKWKHUHSUHVHQWDWLYHVDQGSHUVRQQHORIWKH'HVLJQHUWRSURYLGHVDIH PHDQVDQGIDFLOLWLHVIRUWKH'HVLJQHUWRREVHUYHDOOSDUWVRIWKHZRUNIRUWKHSXUSRVHRIGHWHUPLQLQJ FRQIRUPDQFHQRQFRQIRUPDQFHZLWKWKHVSHFLILFDWLRQV & &RQWUDFWRUPXVWQRWLI\WKH'HVLJQHUDPLQLPXPRIKRXUVSULRUWRVSHFLILFDFWLYLWLHVIRUZKLFK WKH'HVLJQHUZLVKHVWREHSUHVHQW7KHDSSOLFDEOHDFWLYLWLHVZLOOEHGHILQHGE\WKH'HVLJQHUGXULQJ WKH3UH&RQVWUXFWLRQ0HHWLQJEXWDUHDQWLFLSDWHGWRLQFOXGHILUVWGD\RIUHPRYDODQGUHSODFHPHQW RQPDLQURRIDUHDVRULQVWDOODWLRQRIVSHFLILFGHWDLOV,I&RQWUDFWRUIDLOVWRQRWLI\WKH'HVLJQHUWR DOORZIRUREVHUYDWLRQ'HVLJQHUPD\UHTXHVWWRREVHUYHZRUNLQFOXGLQJFRYHUHGZRUNWRFRQILUP FRQIRUPDQFHZLWKWKHFRQWUDFWGRFXPHQWVDWQRDGGLWLRQDOFRVWWRWKH2ZQHU 3$57 352'8&76±12786(' 3$57 (;(&87,21±12786(' (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±%$6(%,'$//2:$1&(6(67,0$7('48$17,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 %$6(%,'$//2:$1&(6(67,0$7('48$17,7,(6 3$57*(1(5$/ 6800$5< $7KLV6HFWLRQLQFOXGHVUHTXLUHPHQWVJRYHUQLQJHVWLPDWHGTXDQWLWLHVRIZRUNWREHLQFOXGHGZLWKLQWKH %DVH%LGFRVWDQGWKHDVVRFLDWHGXQLWSULFHVUHTXHVWHGWRDLGLQUHFRQFLOLDWLRQEHWZHHQTXDQWLWLHV HVWLPDWHGDQGDFWXDOZRUNSHUIRUPHG5HIHUWR6HFWLRQIRUDGGLWLRQDOLQIRUPDWLRQUHJDUGLQJ %DVH%LGVFRSHRIZRUN %5HIHUWRVSHFLILFDWLRQVHFWLRQVDQGIRUWHFKQLFDOUHTXLUHPHQWVUHJDUGLQJEDVH ELGDOORZDQFHHVWLPDWHGTXDQWLW\ZRUN 68%0,77$/6 $ 3URYLGHVXEPLWWDOVIRUSURGXFWVWREHUHSDLUHGUHPRYHGDQGRULQVWDOOHGDVDSDUWRIWKHZRUNLQ DFFRUGDQFHZLWK6HFWLRQDQGWKHWHFKQLFDOVSHFLILFDWLRQVHFWLRQVLQZKLFKWKH\DUHVSHFLILHG (67,0$7('48$17,7<:25. $ (VWLPDWHGTXDQWLWLHVDUHSURYLGHGEHORZIRUUHSODFHPHQWRIPDWHULDOVGLVFRYHUHGWREHGHWHULRUDWHG GDPDJHGPLVVLQJDQGRULQVWDOODWLRQRIDGGLWLRQDOZRUNWKDWLVQRWVSHFLILFDOO\GHVLJQDWHGLQWKH VSHFLILFDWLRQVEXWPD\EHFRPHQHFHVVDU\7KHFRVWWRSHUIRUPWKHHVWLPDWHGTXDQWLW\RIHDFKZRUN LWHPOLVWHGEHORZVKDOOEHLQFOXGHGZLWKLQWKH%DVH%LG Unit Price Work Item Estimated Quantity 0HWDO'HFN5HVWRUDWLRQSHU6HFWLRQ VTIW 0HWDO'HFN5HSODFHPHQWSHU6HFWLRQ VTIW 0HWDO'HFN5HSDLUSHU6HFWLRQ VTIW :RRG%ORFNLQJ5HSODFHPHQWSHU6HFWLRQ EGIW 3O\ZRRG5HSODFHPHQWSHU6HFWLRQ VTIW ´*\SVXP%RDUGUHSODFHPHQWSHU6HFWLRQ VTIW $GGLWLRQDO:DON7UHDG,QVWDOODWLRQSHU6HFWLRQ OQIW 5XEEHUSDYHUSHU6HFWLRQ HDFK 7DSHUHG,QVXODWLRQSHU6HFWLRQ EGIW 81,735,&(6)25(67,0$7('48$17,7<:25.,7(06 $$XQLWSULFHIRUHDFKRIWKHHVWLPDWHGTXDQWLW\ZRUNLWHPVOLVWHGDERYHLVUHTXHVWHGRQWKH)RUPRI 3URSRVDO8QLWSULFHVSURYLGHGE\WKH&RQWUDFWRUZLOOEHXVHGIRUWKHSXUSRVHRIDGGLQJRUGHGXFWLQJ IURPWKH&RQWUDFW6XPE\&KDQJH2UGHULQWKHHYHQWWKDWWKHDFWXDOSHUIRUPHGDPRXQWVRIHDFK HVWLPDWHGTXDQWLW\ZRUNLWHPOLVWHGLQ3DUDJUDSK$DUHPRUHWKDQRUOHVVWKDQWKHHVWLPDWHG TXDQWLW\LQFOXGHGLQWKH%DVH%LG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±%$6(%,'$//2:$1&(6(67,0$7('48$17,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW % 7KHXQLWSULFHVSURYLGHGRQWKH)RUPRI3URSRVDOVKDOOLQFOXGHDOOFRVWVDVVRFLDWHGZLWKWKHZRUN LQFOXGLQJEXWQRWOLPLWHGWRUHPRYDORIPDWHULDOVWREHUHSODFHGSUHSDUDWLRQRIVXEVWUDWHVDQG DGMDFHQWVXUIDFHVIRUDVVRFLDWHGLQVWDOODWLRQDQGPDWHULDOODERURYHUKHDGDQGSURILWLQVXUDQFH WD[HVVKLSSLQJFRVWVDFFHVVRU\LWHPVHTXLSPHQWWRROV 3$57352'8&761RW8VHG 3$57(;(&87,211RW8VHG 35(3$5$7,21$1',167$//$7,21 $ 3UHSDUHVXSSO\DQGLQVWDOOSURGXFWVDVVRFLDWHGZLWKHVWLPDWHGTXDQWLW\ZRUNLQDFFRUGDQFHZLWKWKH WHFKQLFDOVSHFLILFDWLRQVHFWLRQVLQZKLFKWKH\DUHVSHFLILHG '2&80(17$7,212)(67,0$7('48$17,7<:25. $ $UHSUHVHQWDWLYHRIWKH2ZQHUDQGRU'HVLJQHUVKRXOGEHPDGHDZDUHZKHQZRUNLWHPVSHUIRUPHGDV DSDUWRIWKHHVWLPDWHGTXDQWLW\ZRUNDUHDQWLFLSDWHGXQOHVVRWKHUZLVHDJUHHGXSRQGXULQJWKHSUH FRQVWUXFWLRQPHHWLQJ % 'RFXPHQWLQJDQGWUDFNLQJRIDFWXDOHVWLPDWHGTXDQWLW\ZRUNSHUIRUPHGLVWKHUHVSRQVLELOLW\RIWKH &RQWUDFWRULVLPSRUWDQWWRDOORZIRUFRPSDULVRQZLWKHVWLPDWHGTXDQWLWLHVGXULQJZRUNSURJUHVVDQGD SURSHUUHFRQFLOLDWLRQRIFRQWUDFWZRUNDWSURMHFWDFFHSWDQFH7KH'HVLJQHU2ZQHUPD\GHQ\SD\PHQW IRU ZRUN SHUIRUPHG E\ WKH &RQWUDFWRU LI DGHTXDWH GRFXPHQWDWLRQRI ZRUN SHUIRUPHG FDQQRW EH SURYLGHG$WPLQLPXPSKRWRJUDSKLFGRFXPHQWDWLRQRIWKHH[LVWLQJFRQGLWLRQUHTXLULQJHVWLPDWHG TXDQWLW\ZRUNUHPRYDORIH[LVWLQJPDWHULDOVDQGLQVWDOODWLRQRIUHSODFHPHQWPDWHULDOVZLOOEHUHTXLUHG LIGLUHFWREVHUYDWLRQE\WKH(QJLQHHURU2ZQHULVQRWSRVVLEOH (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±352-(&70((7,1*6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 352-(&70((7,1*6 3$57*(1(5$/ 35(&216758&7,21&21)(5(1&( $7KH(QJLQHHUZLOOVFKHGXOHDQGDGPLQLVWHUD3UH&RQVWUXFWLRQ&RQIHUHQFHXSRQDZDUGDQGH[HFXWLRQ RIWKHFRQWUDFW5HSUHVHQWDWLYHVRIWKH2ZQHU(QJLQHHU&RQWUDFWRUDQGUHSUHVHQWDWLYHVRIRWKHU *RYHUQPHQWDORUUHJXODWRU\DJHQFLHVDVQHFHVVDU\VKDOOEHLQDWWHQGDQFH7KH&RQWUDFWRU¶V3URMHFW 0DQDJHUDQWLFLSDWHG6LWH6XSHULQWHQGHQW)RUHPDQDUHSUHVHQWDWLYHRIWKHURRIV\VWHPPDQXIDFWXUHU DQGDSSOLFDEOHVXEFRQWUDFWRUVVKDOOEHSUHVHQWDWWKH3UH&RQVWUXFWLRQ&RQIHUHQFHXQOHVVRWKHUZLVH GLVFXVVHGDQGDJUHHGXSRQ(QJLQHHUVKDOOGLVWULEXWHPHHWLQJPLQXWHVWRDOODWWHQGHHV %6XJJHVWHG$JHQGD&RQILUPDWLRQRIWKHH[HFXWLRQRI2ZQHU&RQWUDFWRU$JUHHPHQWH[FKDQJHDQG GLVFXVVLRQRISUHOLPLQDU\VXEPLWWDOVDQGSURFHGXUHVGHVLJQDWLRQRINH\UHSUHVHQWDWLYHVDQGSHUVRQQHO GLVFXVVLRQRIFRQVWUXFWLRQVFKHGXOH DQGZRUN VHTXHQFLQJGHVLJQDWHG VWRUDJH DQGSDUNLQJ DUHDV VHFXULW\DQGKRXVHNHHSLQJSURFHGXUHVPDLQWHQDQFHRIUHFRUGGRFXPHQWVDQGWHFKQLFDOPDWHULDODQG LQVWDOODWLRQLQIRUPDWLRQ 352*5(660((7,1*6 $ (QJLQHHUZLOOVFKHGXOHDQGDGPLQLVWHUSURJUHVVPHHWLQJVWKURXJKRXWSURJUHVVRIWKH:RUNDWUHJXODU DQGDSSURSULDWHLQWHUYDOV)RUWKLVSURMHFWPHHWLQJIUHTXHQF\ZLOOEHHYHU\WZRZHHNV,ILVVXHVDULVH WKDWUHTXLUHDGGLWLRQDOFRRUGLQDWLRQWKH'HVLJQHUZLOOVFKHGXOHFRQIHUHQFHFDOOVEHWZHHQSURJUHVV PHHWLQJV % (QJLQHHUZLOOPDNHSK\VLFDODUUDQJHPHQWVIRUPHHWLQJVSUHVLGHDWPHHWLQJVUHFRUGPLQXWHVDQG GLVWULEXWHFRSLHVRIWKHPLQXWHVWRWKH2ZQHU&RQWUDFWRURWKHUPHHWLQJSDUWLFLSDQWVDQGWKRVHDIIHFWHG E\GHFLVLRQVPDGHDWPHHWLQJV & $WWHQGDQFH &RQWUDFWRU¶V SURMHFW PDQDJHU &RQWUDFWRU¶V VXSHULQWHQGHQW DQG IRUHPDQ PDMRU VXEFRQWUDFWRUV DQG VXSSOLHUV DV DSSOLFDEOH 2ZQHU¶V UHSUHVHQWDWLYH DQG (QJLQHHU $GGLWLRQDO DWWHQGHHVPD\EHUHTXHVWHGDVDSSURSULDWHWRDJHQGDWRSLFVIRUHDFKPHHWLQJ ' 6XJJHVWHG$JHQGD5HYLHZRIZRUNSURJUHVVVWDWXVRISURJUHVVVFKHGXOHDQGFRQWUDFWVXPDQG DGMXVWPHQWVWKHUHWRGHOLYHU\VFKHGXOHVVXEPLWWDOVPDLQWHQDQFHRITXDOLW\VWDQGDUGVSHQGLQJFKDQJHV DQGVXEVWLWXWLRQVDQGRWKHULWHPVDIIHFWLQJSURJUHVVRI:RUN 3$57352'8&761RW8VHG 3$57(;(&87,211RW8VHG (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±68%0,77$/6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 68%0,77$/6 3$57*(1(5$/ 352&('85(6 $ 0DNHVXEPLWWDOVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVLQDWLPHO\PDQQHUWRDOORZIRUVXIILFLHQWUHYLHZ DQGDSSURYDOE\WKH(QJLQHHU5HYLVHDQGUHVXEPLWDVQHFHVVDU\WRHVWDEOLVKFRPSOLDQFHZLWKWKH VSHFLILHGUHTXLUHPHQWV6XEPLWGRFXPHQWVWR(QJLQHHUHOHFWURQLFDOO\ZLWK6XEPLWWDO)RUP6) DWWDFKHGWRGRFXPHQWDQGFRQVHFXWLYHO\QXPEHUHG$QHOHFWURQLFYHUVLRQRI6)ZLOOEHPDGH DYDLODEOHXSRQUHTXHVW :25.,1&/8'(' $ (OHFWURQLFFRSLHVRIVXEPLWWDOVDUHSUHIHUUHG(DFKVXEPLWWDOPXVWEHDFFRPSDQLHGZLWKDWUDQVPLWWDO IRUPDVSURYLGHGDWWKHHQGRIWKLVVHFWLRQ)RULWHPVWKDWFDQQRWEHVXEPLWWHGHOHFWURQLFDOO\ODUJH IRUPDWVKRSGUDZLQJVSK\VLFDOVDPSOHVFRORUFKDUWVRUFKLSVPHPEUDQHVDPSOHVHWFGHOLYHUWRWKH (QJLQHHUIRUUHYLHZ3K\VLFDOVXEPLWWDOVPXVWVWLOOEHDFFRPSDQLHGE\DWUDQVPLWWDOVKHHW % 7KH:RUNPD\QRWSURFHHGXQWLOWKHFRPSOHWHSUHMREVXEPLWWDOSDFNDJHLQFOXGLQJVKRSGUDZLQJV KDV EHHQ UHYLHZHG DQG DSSURYHG E\ WKH (QJLQHHU 8SGDWH VXEPLWWDOV WR WKH (QJLQHHU GXULQJ FRQVWUXFWLRQWRDFFRXQWIRUQHZHTXLSPHQWSURGXFWVHWFXVHGRQWKHSURMHFW(QJLQHHUPD\HOHFWWR DOORZSKDVHGVXEPLWWDOVWRPHHWZRUNVFKHGXOHLIDJUHHGXSRQLQDGYDQFHZLWKWKH&RQWUDFWRU & $WWKHHQGRIWKHSURMHFWVXEPLWDPLQLPXPRIIRXUFRPSOHWHVHWVRI3RVW-RE6XEPLWWDOVWRWKH (QJLQHHUIRUUHYLHZIROORZLQJWKHILQDODFFHSWDQFHRIWKH:RUN7KHVHVXEPLWWDOVPXVWEHSURYLGHG DVKDUGFRSLHVGXHWRWKHW\SHVRIGRFXPHQWVLQYROYHG5HTXHVWVIRUILQDOSD\PHQWZLOOQRWEHDSSURYHG XQWLOWKH3RVW-RE6XEPLWWDOSDFNDJHKDVEHHQDFFHSWHGE\WKH2ZQHU2UJDQL]HSRVWMREVXEPLWWDOV NH\HGWRDOLVWRILWHPVUHTXLUHGXQGHU$UWLFOHRIWKLV6HFWLRQ ' ,GHQWLI\LQGLYLGXDOVXEPLWWDOVE\SURGXFWW\SHRUQDPHRQWKHVXEPLWWDOIRUPDQGLQFOXGHDWDEOHRI FRQWHQWVLQHDFKVXEPLWWDOSDFNDJHRUWUDQVPLWWDOHPDLOOLVWLQJLWHPVLQFOXGHG ( 6XEPLWWDOVOLVWHGLQWKLV6HFWLRQDQGUHTXLUHGE\RWKHU6HFWLRQVWREHVXEPLWWHGLQDFFRUGDQFHZLWKWKLV 6HFWLRQDUHDSSOLFDEOH,ILQWKHRSLQLRQRIWKH&RQWUDFWRUDQLWHPOLVWHGLVQRWDSSOLFDEOHWKH &RQWUDFWRU PXVW VXEPLW GRFXPHQWDWLRQ VXEVWDQWLDWLQJ KLV SRVLWLRQ /LNHZLVH LI D VXEPLWWDO LV XQDYDLODEOHWKH&RQWUDFWRUPXVWVXEPLWGRFXPHQWDWLRQUHFRQVWUXFWLQJWKHPLVVLQJLQIRUPDWLRQDVEHVW DVFDQEHDFFRPSOLVKHG &2175$&725 635(-2%68%0,77$/6 $ 7KHIROORZLQJPDWHULDODQGSURGXFWVXEPLWWDOVVKDOOEHSURYLGHG 3URGXFWGDWDIRUHDFKPDWHULDODQGSURGXFWWREHLQVWDOOHGWRFRQILUPFRQIRUPDQFHZLWKVSHFLILHG UHTXLUHPHQWVRUWRSURYLGHLQIRUPDWLRQRQDGGLWLRQDOSURGXFWVUHTXLUHGIRULQVWDOODWLRQ 3URGXFWPDQXIDFWXUHUV¶LQVWDOODWLRQLQVWUXFWLRQVIRUHDFKPDWHULDODQGSURGXFWWREHLQVWDOOHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±68%0,77$/6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 3URGXFW6'6IRUHDFKPDWHULDOWREHLQVWDOOHGDQGDVVRFLDWHGHTXLSPHQWSURGXFWVWREHXVHG GXULQJLQVWDOODWLRQ 0DWHULDOVDPSOHVRIPHPEUDQHLQVXODWLRQPHWDOHWFWREHXVHGDVUHTXHVWHGE\WKH(QJLQHHU 0DWHULDOVDPSOHVPXVWKDYHPDQXIDFWXUHU¶VSURGXFWLGHQWLILFDWLRQRQWKHVDPSOH &RORUVHOHFWLRQPDWHULDOVIRUSUHILQLVKHGPHWDOVHDODQWVRURWKHUSURGXFWVDVQRWHGLQWKH DSSOLFDEOHVSHFLILFDWLRQVHFWLRQV3K\VLFDOPHWDOFKLSVDPSOHVLQDGGLWLRQWRDFRORUFKDUWZLOOEH UHTXHVWHGIRUSUHILQLVKHGPHWDOFRORUVHOHFWLRQ % 7KHIROORZLQJWHFKQLFDOVXEPLWWDOVVKDOOEHSURYLGHG 'HWDLOHGRXWOLQHRIWKHPHWKRGVDQGPHDQVWREHIROORZHGGXULQJWKHLQVWDOODWLRQRIWKHURRI V\VWHP 2QFH DFFHSWHG WKLV RXWOLQH PD\ RQO\ EH FKDQJHG ZLWK ZULWWHQ DSSURYDO ,QFOXGH SURFHGXUHVWRNHHSURRIDUHDVGU\WKURXJKHDFKVWDJHRIWKHFRQVWUXFWLRQSURFHVV(PHUJHQF\ FRQWDFWQXPEHUVZLOOEHSURYLGHGZLWKSODQVIRUFKHFNLQJWKHEXLOGLQJLQWHULRUGXULQJUDLQHYHQWV DQGPD[LPXPUHVSRQVHWLPHVOLVWHG 6KRSGUDZLQJVIRUGHWDLOVRUFRQVWUXFWLRQVIRUWKHSXUSRVHRISURYLGLQJDGGLWLRQDOLQIRUPDWLRQ VXFKDVGHWDLOFRQILJXUDWLRQVDQGPHWDOIDEULFDWLRQVKDSHVDQGVL]HVHWF6KRZVHFXUHPHQW SDWWHUQVIRUWKHLQVXODWLRQDVZHOODVSHULPHWHUDQGFRUQHUGLPHQVLRQVWRPHHWFRGHUHTXLUHG DQGVSHFLILHGZLQGXSOLIWORDGV,IDQ\GHWDLOVSURYLGHGRQWKHVKRSGUDZLQJVYDU\IURPWKRVH VKRZQRQWKHSURMHFWGRFXPHQWVWKH&RQWUDFWRUPXVWQRWHVXFKYDULDQFHRQWKHVXEPLWWDOWR LQGLFDWHWKDWDFKDQJHLVUHTXHVWHG7KH(QJLQHHUZLOOUHYLHZVXFKUHTXHVWHGUHYLVLRQVDQGZLOO DSSURYHRUUHMHFWDWWKHLUVROHGLVFUHWLRQ &HUWLILFDWLRQV WKDW PDWHULDOV WR EH LQVWDOOHG DUH DVEHVWRVIUHH DQG DUH FRPSDWLEOH ZLWK WKH VXEVWUDWHVWRZKLFKWKH\ZLOOEHDSSOLHG /HWWHUIURPWKHURRIV\VWHPPDQXIDFWXUHUVWDWLQJWKDWWKH&RQWUDFWRURUVXEFRQWUDFWRUZKHQ DSSOLFDEOHLVDQDSSURYHGDSSOLFDWRURILWVURRIV\VWHPDVVSHFLILHG /HWWHUIURPWKHURRIV\VWHPPDQXIDFWXUHULQGLFDWLQJUHYLHZRIWKHSURMHFWGRFXPHQWVDFFHSWDQFH RIGHVLJQLQWHQWDQGGHWDLOVDVVKRZQDQGLQWHQWWRLVVXHWKHVSHFLILHGZDUUDQW\LQFOXGLQJ DFNQRZOHGJPHQWRIDQ\ZDUUDQW\PRGLILFDWLRQVVSHFLILHG5HIHUWR6HFWLRQIRUDGGLWLRQDO LQIRUPDWLRQ/HWWHUPXVWEHSURMHFWVSHFLILFDQGVKDOOLQFOXGHWKHW\SHDQGGXUDWLRQRIZDUUDQW\ ULGHUV DQ\ PDQXIDFWXUHU¶V DGGLWLRQDO UHTXLUHPHQWV DQG D VDPSOH FRS\ RI DFWXDO \HDU ZDUUDQW\LQFOXGLQJPDWHULDOVDQGZHDWKHUWLJKWQHVVDVDSSOLFDEOH $VDPSOHFRS\RIWKH&RQWUDFWRU¶V7ZR<HDU:DUUDQW\ 3UH-RE'DPDJH6XUYH\LQDFFRUGDQFHZLWK6HFWLRQRIWKLV3URMHFW0DQXDO $GGLWLRQDOVXEPLWWDOVDVUHTXHVWHGLQHDFKVHFWLRQ & 7KHIROORZLQJDGPLQLVWUDWLYHVXEPLWWDOVVKDOOEHSURYLGHG %XLOGLQJSHUPLWVDVUHTXLUHGE\WKHIHGHUDOVWDWHRUDQ\ORFDOHQWLW\IRUWKHFRQVWUXFWLRQRU GHPROLWLRQZRUNUHTXLUHGGXULQJWKHSURJUHVVRIWKH:RUN,IQRSHUPLWVDUHUHTXLUHGVRVWDWH 3URSRVHGSUHOLPLQDU\SURJUHVVVFKHGXOHIRUWKH:RUN5HYLVHDQGVXEPLWSURJUHVVVFKHGXOHDV QHFHVVDU\ 5HYLHZ 2ZQHU UHTXLUHPHQWV IRU SURJUHVV VFKHGXOHV 3URJUHVV VFKHGXOHV VKRXOG LQFOXGHOLQHLWHPVIRUVSHFLILFZRUNDFWLYLWLHVDWHDFKURRIDUHDRUJURXSRIDUHDVZLWKERWK VFKHGXOHGDWHVIRUWKHOLQHLWHPDQGDJUDSKLFDOUHSUHVHQWDWLRQRIWKRVHGDWHVDORQJZLWKDOLQHWR FRPSDUHDFWXDOVFKHGXOHSURJUHVV 6FKHGXOHRI9DOXHVIRUWKHSURMHFW:RUN,WHPVVKDOOEHJHQHUDOO\GLYLGHGE\3URMHFW0DQXDO 6HFWLRQDQGLQWRPDWHULDOVDQGODERUFRVW&RSLHVRILQYRLFHVTXRWHVIURPVXSSOLHUIRUPDWHULDOV PD\EHUHTXHVWHGWRHQVXUHWKDWPDWHULDOFRVWVOLVWHGDUHQRWVLJQLILFDQWO\LQFUHDVHGLQFRPSDULVRQ WRODERUFRVWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±68%0,77$/6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ,QVXUDQFHFHUWLILFDWHLVVXHGWR2ZQHUE\&RQWUDFWRU VLQVXUDQFHFDUULHUOLVWLQJUHTXLUHGFRYHUDJH LIQRWDOUHDG\UHTXLUHGIRUVXEPLWWDODVDSDUWRIH[HFXWLRQRIWKHFRQVWUXFWLRQFRQWUDFW :ULWWHQVHFXULW\SODQLIUHTXLUHGE\WKH2ZQHU &RQWUDFWRU6DIHW\3URJUDPVSHFLILFDOO\GHVLJQHGIRUWKLVSURMHFWWKDWUHFRJQL]HVDQGPLWLJDWHV WKHVSHFLILFKD]DUGVSUHVHQWLQSHUIRUPLQJWKH:RUN 3URYLGHDOLVWRIDQ\VXEFRQWUDFWRUVWREHXWLOL]HGLQSHUIRUPDQFHRIWKHZRUN6XEPLWLQIRUPDWLRQ UHJDUGLQJWKHVXEFRQWUDFWRUVLQFOXGLQJFRQWDFWLQIRUPDWLRQFRSLHVRIOLFHQVHVFHUWLILFDWLRQVDQG UHIHUHQFHVLIUHTXHVWHG &2175$&725 63267-2%68%0,77$/6 $ 3URYLGHDOORULJLQDOFRSLHVXQOHVVRWKHUZLVHQRWHGRIHDFKRIWKHIROORZLQJSRVWMREVXEPLWWDOV )LQDO$SSOLFDWLRQIRU3D\PHQWRULJLQDOFRSLHV &RQVHQWRI6XUHW\WR)LQDO3D\PHQW &RQWUDFWRU¶V$IILGDYLWRI5HOHDVHRI/LHQVSURSHUO\VLJQHGQRWDUL]HGHWF &RQWUDFWRU¶V$IILGDYLWRI3D\PHQWRI'HEWVDQG&ODLPV 3URSHUO\H[HFXWHGUHOHDVHRIOLHQVE\VXEFRQWUDFWRUVDQGRUYHQGRUV &HUWLILFDWLRQOHWWHUWKDWQRDVEHVWRVFRQWDLQLQJPDWHULDOVZHUHXVHG )LQDOOLVWRIDOOVXEFRQWUDFWRUVDQGVXSSOLHUVZLWKQDPHVDGGUHVVHVDQGSKRQHQXPEHUV 6SHFLILFRSHUDWLQJDQGPDLQWHQDQFHPDQXDOVIRUWKHQHZURRIV\VWHPDQGFRPSRQHQWV 'XSOLFDWHQRWDUL]HGFRSLHVRIWKH&RQWUDFWRU¶V\HDUDQGWZRRULJLQDOVRIWKH0DQXIDFWXUHU¶V ZDUUDQW\ 2QHVHWRIDVEXLOWGUDZLQJVLQFOXGLQJDFRS\RIERWKGHVLJQDQGVKRSGUDZLQJVZLWKFKDQJHV FOHDUO\PDUNHG5HG/LQHG'UDZLQJV 3$57±352'8&76±1RW8VHG 3$57(;(&87,21 ,'(17,),&$7,212)68%0,77$/6 $ 1XPEHUFRQVHFXWLYHO\DQGFOHDUO\LGHQWLI\VXEPLWWDOV6XEPLWWDO)RUP6)PXVWDFFRPSDQ\HDFK VXEPLWWDO SDFNDJH SURYLGHG 7KLV IRUP ZLOO EH SURYLGHG HOHFWURQLFDOO\ LI UHTXHVWHG 6KRZ LGHQWLILFDWLRQRQDWOHDVWWKHILUVWSDJHRIHDFKVXEPLWWDODQGHOVHZKHUHDVQHFHVVDU\IRUSRVLWLYH LGHQWLILFDWLRQRIWKHVXEPLWWDO :KHQPDWHULDOLVUHVXEPLWWHGFLWHWKHRULJLQDOVXEPLWWDOQXPEHUIRUUHIHUHQFHDQGDGGDVXIIL[ VXFKDV$%$%HWF % 0DLQWDLQ DQ DFFXUDWH VXEPLWWDO ORJ IRU WKH GXUDWLRQ RI WKH :RUN VKRZLQJ FXUUHQW VWDWXV RI DOO VXEPLWWDOV0DNHWKHVXEPLWWDOORJDYDLODEOHWRWKH2ZQHU¶VUHSUHVHQWDWLYHIRUWKHLUUHYLHZ & .HHSRQHDSSURYHGVHWRIGHVLJQDQGVKRSGUDZLQJVVSHFLILFDWLRQVDQGVXEPLWWDOVLQFOXGLQJGDWD VKHHWVLQVWUXFWLRQVKHHWVHWFDWWKHMREVLWH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±68%0,77$/6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 7,0,1*2)68%0,77$/6 $ 0DNHVXEPLWWDOVIDUHQRXJKLQDGYDQFHRIVFKHGXOHGGDWHVRI1RWLFHWR3URFHHGDQGWKHVWDUWRIZRUN RULQVWDOODWLRQRIVSHFLILFSURGXFWVWRSURYLGHWLPHUHTXLUHGIRUUHYLHZE\WKH(QJLQHHUIRUVHFXULQJ QHFHVVDU\ DSSURYDOVIRUSRVVLEOH UHYLVLRQVDQG UHVXEPLWWDOV DQGIRUSODFLQJ RUGHU DQG VHFXULQJ GHOLYHU\RIPDWHULDOV % ,QVFKHGXOLQJDOORZDPLQLPXPRIWHQZRUNLQJGD\VIURPGDWHRI(QJLQHHU¶VUHFHLSWRIWKH VXEPLWWDOIRUKLVUHYLHZ &&RQWUDFWRUDFFHSWVUHVSRQVLELOLW\IRUGHOD\VUHVXOWLQJIURPLQFRPSOHWHRUODWHVXEPLWWDOSDFNDJHV ':RUNFRPSOHWHGZLWKRXWDSSURYHGVXEPLWWDOVPD\EHVXEMHFWWRUHMHFWLRQ '(6,*1(5 65(9,(: $ 3DUWLDOVXEPLWWDOVPD\EHUHMHFWHGIRUQRQFRPSOLDQFHZLWKWKH&RQWUDFW'RFXPHQWV % 5HYLHZE\'HVLJQHUGRHVQRWUHOLHYH&RQWUDFWRUIURPUHVSRQVLELOLW\RIFRQIRUPLQJWRWKHWHFKQLFDO VSHFLILFDWLRQVDQGGUDZLQJVRUIRUHUURUVZKLFKPD\H[LVWLQWKHVXEPLWWHGGDWD & 5HYLVLRQV 0DNHUHYLVLRQVZKHQUHTXLUHGE\'HVLJQHUDQGUHVXEPLWIRUUHYLHZ ,IWKH&RQWUDFWRUFRQVLGHUVDQ\UHTXLUHGUHYLVLRQWREHDFKDQJHKHVKDOOVRQRWLI\WKH'HVLJQHU DVSURYLGHGIRULQWKHDUWLFOHIRU&KDQJHVLQWKH:RUNRIWKH*HQHUDO&RQGLWLRQV 0DNHRQO\WKRVHUHYLVLRQVGLUHFWHGRUDSSURYHGE\WKH'HVLJQHU ' 7KH(QJLQHHUZLOOSURYLGHDQLQLWLDOUHYLHZDQGXSWRWZRVXEVHTXHQWUHYLHZVRIHDFKUHTXLUHG VXEPLWWDO6XEPLWWDOUHYLHZVLQH[FHVVRIWKLVGXHWRLQFRPSOHWHVXEPLWWDOVRUIDLOXUHWRDGGUHVVUHYLHZ FRPPHQWV PD\ UHVXOW LQ DGGLWLRQDO FRVW WR WKH 2ZQHU 7KH 2ZQHUUHVHUYHV WKH ULJKW WR UHTXLUH UHLPEXUVHPHQWRIWKLVDGGLWLRQDOFRVWE\WKH&RQWUDFWRU &/$,06)25(;75$&2671RFODLPIRUH[WUDFRVWVKDOOEHDSSURYHGVROHO\EDVHGRQZRUNVKRZQ RQVKRSGUDZLQJVXQOHVVVXFKFODLPLVPDGHRQWKH&RQWUDFWRU VOHWWHURIWUDQVPLWWDODFFRPSDQ\LQJWKH VKRSGUDZLQJVDQGLVDSSURYHGE\WKH2ZQHULQZULWLQJ (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 68%0,77$/75$160,77$/)250 7KLV)RUP0XVW%H3K\VLFDOO\$WWDFKHG7R(DFK6XEPLWWDO$QG0XVW%H1XPEHUHG&RQVHFXWLYHO\ 3URMHFW1DPH6SRUWVSOH[5RRI5HSODFHPHQW &RGH &RQWUDFWRU1DPH 6SHFLILFDWLRQ6HFWLRQ1XPEHU 6XEFRQWUDFWRU 3URGXFW7\SH 3URGXFW7UDGH1DPH 0DMRU6XSSOLHU $SSOLFDEOH'UDZLQJRU'HWDLO 5HPDUNV 6XEPLWWDO,GHQWLILFDWLRQ 8VH8QLTXH,'IRU$WWDFKPHQW 6XEPLWWDO1XPEHU 'DWHRI6XEPLWWDO 6($/ &RQWUDFWRU6HDO ,KDYHUHYLHZHGWKHDWWDFKHGVXEPLWWDODQGLWFRPSOLHV ZLWKWKHUHTXLUHPHQWVRIWKH*HQHUDO&RQGLWLRQVDQG RWKHUDSSOLFDEOHVHFWLRQVRIWKH&RQWUDFW'RFXPHQWV 6LJQDWXUHRI&RQWUDFWRU )25'(6,*1(5 686(21/< '$7(5(&(,9(' '$7(5(7851(' $7/$6-RE1R- 1RFRUUHFWLRQVQRWHG 0DNHFRUUHFWLRQVQRWHG 5HYLVHDQGUHVXEPLW 1RWDFFHSWDEOHVHHUHPDUNV 5HYLHZLVRQO\IRUJHQHUDOFRQIRUPDQFHZLWKWKHGHVLJQ FRQFHSWRIWKHSURMHFWDQGJHQHUDOFRPSOLDQFHZLWKWKH LQIRUPDWLRQJLYHQLQWKHFRQWUDFWGRFXPHQWV &RQWUDFWRULVUHVSRQVLEOHIRUFRPSOLDQFHZLWKFRQWUDFW GRFXPHQWV FRQILUPLQJ DQGFRUUHODWLQJ DOO TXDQWLWLHV DQG GLPHQVLRQV VHOHFWLQJIDEULFDWLRQ SURFHVVHV DQG WHFKQLTXHVLQFOXGLQJPHDQVPHWKRGVDQGVHTXHQFLQJ RIFRQVWUXFWLRQFRRUGLQDWLQJWKHZRUNZLWKWKDWRIDOO RWKHUWUDGHVDQGSHUIRUPDQFHRIWKHZRUNLQDVDIHDQG VDWLVIDFWRU\PDQQHU $7/$6(1*,1((5,1*,1& %< '$7( &RUUHFWLRQV1RWHG 5HPDUNV 6) DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±48$/,7<&21752/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 48$/,7<&21752/ 3$57*(1(5$/ 6800$5< $ 0DLQWDLQ TXDOLW\ FRQWURO RYHU VXSSOLHUV PDQXIDFWXUHUV SURGXFWV VHUYLFHV VLWH FRQGLWLRQV DQG ZRUNPDQVKLSWRSURGXFH:RUNRIVSHFLILHGTXDOLW\ &2175$&725:25.0$16+,3 $ 7KH,QVWDOOHUVRIWKHVLQJOHSO\URRIV\VWHPPXVWEHDSSURYHGFHUWLILHGDSSOLFDWRUVRIWKHPDQXIDFWXUHU V\VWHPVSURGXFWVWREHLQVWDOOHG7KHFHUWLILFDWLRQDSSURYDOPXVWEHSURYLGHGE\WKHPDQXIDFWXUHUDQG PXVW EH EDVHG RQ LQVWDOODWLRQ WUDLQLQJ FRQWUDFWRU H[SHULHQFH ZLWK WKH V\VWHP DQG LQVWDOODWLRQ SHUIRUPDQFHDQGWHFKQLFDOREVHUYDWLRQQRWVROHO\RQVDOHVUDQNLQJ$SSURYDOFHUWLILFDWLRQVPXVWKDYH EHHQLQSODFHSULRUWRWKHELGGDWH7KHSULPHFRQWUDFWVKDOOHLWKHUEHDSSURYHGWKHPVHOYHVRUVKDOO XVHDSSURYHGVXEFRQWUDFWRUVWRSHUIRUPWKHZRUNRQWKLVSURMHFWDQGVKDOOOLVWWKHPRQWKH)RUPRI 3URSRVDO&HUWLILFDWLRQDSSURYDOPD\EHUHTXHVWHGIRUWKHSXUSRVHRIUHYLHZLQJDQGHYDOXDWLQJELGV DQGIDLOXUHWRSURYLGHUHTXHVWHGGRFXPHQWDWLRQPD\UHVXOWLQGLVTXDOLILFDWLRQRIELG % 7KHELGGLQJFRQWUDFWRUVKDOOKDYHEHHQLQEXVLQHVVDPLQLPXPRIWZR\HDUVSULRUWRWKHGDWHRIELG DQGPXVWKDYHRUXWLOL]HDVXEFRQWUDFWRUZKRKDVDPLQLPXPRI\HDU¶VSULRUH[SHULHQFHZLWK LQVWDOODWLRQ RI WKH VSHFLILHG URRI V\VWHPV RQ FRPPHUFLDO RU SXEOLF EXLOGLQJV 8SRQ UHTXHVW &RQWUDFWRUPXVWEHDEOHWRSURYLGHGRFXPHQWDWLRQRIDJHRIEXVLQHVVDQGRIFRPSOHWHGSURMHFWVRIWKH VDPHV\VWHPZLWKVLPLODUVL]HDQGVFRSH7KLVGRFXPHQWDWLRQPD\EHUHTXHVWHGIRUWKHSXUSRVHRI UHYLHZLQJ DQG HYDOXDWLQJ ELGV DQG IDLOXUH WR SURYLGH UHTXHVWHGGRFXPHQWDWLRQ PD\ UHVXOW LQ GLVTXDOLILFDWLRQRIELG & 5RRIV\VWHPLQFOXGLQJPHPEUDQHLQVXODWLRQFODGPHWDOVKHHWPHWDODQGDFFHVVRU\FRPSRQHQWV VKDOOEHLQVWDOOHGLQDZDWHUWLJKWFRQGLWLRQDQGZLWKDQRYHUDOOTXDOLW\RIV\VWHPLQVWDOODWLRQWKDW ZLOODOORZWKHPHPEUDQHDQGIODVKLQJVWRFRQWLQXHWRSHUIRUPLQDZDWHUWLJKWFRQGLWLRQZLWK UHDVRQDEOHPDLQWHQDQFHRYHUWKHV\VWHPPDQXIDFWXUHUZDUUDQW\SHULRG:RUNPXVWEHSHUIRUPHG E\SHUVRQVTXDOLILHGWRSURGXFHZRUNPDQVKLSRIWKHDERYHTXDOLW\3URMHFW0DQDJHUDQG3URMHFW 6XSHULQWHQGHQWPXVWKDYHVSHFLILFH[SHULHQFHZLWKWKHV\VWHPVWREHLQVWDOOHGDQGRQSURMHFWVRI VLPLODUVL]HDQGFRPSOH[LW\ ' &RQWUDFWRU PXVW PDLQWDLQ WKH VDPH 3URMHFW 0DQDJHU DQG 6XSHULQWHQGHQW WKURXJKRXW WKH SURMHFW GXUDWLRQXQOHVVDFKDQJHLVUHYLHZHGE\DQGDJUHHGXSRQE\WKH2ZQHU7KH&RQWUDFWRUPXVWUHSODFH WKH3URMHFW0DQDJHURU6XSHULQWHQGHQWLIVSHFLILFDOO\UHTXHVWHGE\WKH2ZQHUGXHWRFRQFHUQVZLWK TXDOLW\ RI ZRUNPDQVKLS RU LQDWWHQWLYHQHVV WR WKH UHTXLUHPHQWV RI WKH SURMHFW ,I ZRUN LV EHLQJ FRPSOHWHGE\DVXEFRQWUDFWRUWKHSULPHFRQWUDFWRUPXVWKDYHDUHSUHVHQWDWLYHSUHVHQWRQVLWHZKLOH VXEFRQWUDFWHGZRUNLVXQGHUZD\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±48$/,7<&21752/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ()RUWKHSXUSRVHRIVDIHW\DQGFRPPXQLFDWLRQWKH&RQWUDFWRUVKDOOKDYHDPLQLPXPRIRQHELOLQJXDO SHUVRQRQVLWHDWDOOWLPHVLIDQ\FUHZPHPEHUWREHSUHVHQWRQVLWHGRHVQRWVSHDNIOXHQW(QJOLVK 'HVLJQDWHGWUDQVODWRUVPXVWKDYHLGHQWLILFDWLRQRIWKLVUROHFOHDUO\YLVLEOHZKLOHRQVLWH )$UHSUHVHQWDWLYHRIWKHFRQWUDFWRUPXVWEHSUHVHQWRQVLWHIXOOWLPHGXULQJZRUNSHUIRUPHGE\WKHLU VXEFRQWUDFWRUDQGVKDOOEHUHVSRQVLEOHIRUHQVXULQJWKDWWKHLUVXEFRQWUDFWRU¶VIROORZLQJWKHVLWHDQG EXLOGLQJUHTXLUHPHQWVIRUWKLVSURMHFWLQFOXGLQJVLWHDFFHVVZRUNKRXUVHWFWRPLQLPL]HGLVUXSWLRQWR WKHEXLOGLQJRFFXSDQWVDQGSXEOLF 0$18)$&785(5¶66(59,&(6$1',192/9(0(17 $ 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUSURYLGLQJWKHGHVLJQGRFXPHQWVWRWKHPDQXIDFWXUHUWRDOORZ IRUUHYLHZDQGDSSURYDOUHJDUGLQJGHVLJQLQWHQWDQGWRFRQILUPDELOLW\RIWKHLUV\VWHPWRPHHWVSHFLILHG UHTXLUHPHQWVDQGVSHFLILHGV\VWHPZDUUDQW\SULRUWRSURYLVLRQRIDELGIRUWKHSURMHFW)DLOXUHRID SDUWLFXODUURRIV\VWHPWRPHHWWKHUHTXLUHPHQWVRIWKHVSHFLILFDWLRQVRUIDLOXUHRIWKHPDQXIDFWXUHUWR SURYLGHLQWHQWWRZDUUDQW\IRUWKHSURMHFWPD\UHVXOWLQWKHUHTXLUHPHQWIRUWKH&RQWUDFWRUWRXWLOL]H DQRWKHUFRQIRUPLQJURRIV\VWHPPDQXIDFWXUHU¶VSURGXFWVDWQRDGGLWLRQDOFRVWWRWKH2ZQHU % &RPSO\ZLWKWKHPDQXIDFWXUHU¶VLQVWDOODWLRQLQVWUXFWLRQVLQFOXGLQJHDFKVWHSLQSURSHUVHTXHQFH 6KRXOG PDQXIDFWXUHU¶V LQVWUXFWLRQV RU GHWDLO UHTXLUHPHQWV EH OHVV VWULQJHQW WKDW WKH &RQWUDFW 'RFXPHQWV XVH WKH PRUH VWULQJHQW UHTXLUHPHQWV ,I WKH PDQXIDFWXUHU¶V LQVWUXFWLRQV RU GHWDLO UHTXLUHPHQWVFRQIOLFWZLWKWKH&RQWUDFW'RFXPHQWVUHTXHVWFODULILFDWLRQIURPWKH(QJLQHHUEHIRUH SURFHHGLQJ (1*,1((5¶6&216758&7,212%6(59$7,216 $ &RQWUDFWRU VKDOOQRWLI\ (QJLQHHU ZHHNO\RIVLJQLILFDQWSURMHFWDFWLYLWLHV &RQWUDFWRU PXVW QRWLI\ (QJLQHHUDPLQLPXPRIKRXUVSULRUWRVSHFLILFDFWLYLWLHVIRUZKLFKWKH(QJLQHHUZLVKHVWREH SUHVHQW7KHDSSOLFDEOHDFWLYLWLHVZLOOEHGHILQHGE\WKH(QJLQHHUGXULQJWKH3UH&RQVWUXFWLRQ 0HHWLQJEXWPD\LQFOXGHILUVWGD\RIWHDURIIDQGUHSODFHPHQWRQVSHFLILFURRIDUHDVRULQVWDOODWLRQ RIVSHFLILFGHWDLOVDQGLQGHSHQGHQWLQVSHFWLRQVRUWHVWLQJE\WKHPDQXIDFWXUHURURWKHUSDUWLHV,I &RQWUDFWRUIDLOVWRQRWLI\(QJLQHHUWRDOORZIRUREVHUYDWLRQ(QJLQHHUPD\UHTXHVWWRREVHUYHZRUN LQFOXGLQJFRYHUHGZRUNWRFRQILUPFRQIRUPDQFHZLWKFRQWUDFWGRFXPHQWVDWQRDGGLWLRQDOFRVWWR WKH2ZQHU % &RQWUDFWRUVKDOOSURYLGHUHDVRQDEOHDFFHVVSHUVRQQHODQGHTXLSPHQWUHTXLUHGE\(QJLQHHUWRREVHUYH WKH:RUN :$55$17<$1'*8$5$17(( $ 3URYLGHD&RQWUDFWRU¶V7ZR<HDU:DUUDQW\IRUDOORIWKHZRUNLQFOXGHGLQWKLVSURMHFW7KH&RQWUDFWRU VKDOOZDUUDQWZRUNPDQVKLSPDWHULDOVDQGZHDWKHUWLJKWQHVVRIWKHURRIV\VWHPDJDLQVWGHIHFWVGXHWR IDXOW\PDWHULDOVSRRUZRUNPDQVKLSRUZRUNQRWLQVWDOOHGLQFRQIRUPDQFHZLWKSURMHFWWHFKQLFDO UHTXLUHPHQWVRUOHYHORITXDOLW\DVUHTXLUHGE\WKHJHQHUDODQGVXSSOHPHQWDOFRQGLWLRQV:DUUDQW\PXVW FRYHUUHSDLURIGLVWUHVVHVWKDWDUHGLVFRYHUHGLQWKHURRIV\VWHPRURWKHULQVWDOOHGZRUNZKHWKHURUQRW WKH\DUHDFWLYHO\FDXVLQJZDWHUHQWU\LQWRWKHV\VWHPRUEXLOGLQJ7KHZDUUDQW\ZLOOH[WHQGIRUDSHULRG RIWZHQW\IRXUPRQWKVIURPWKHGDWHRI)LQDO&RPSOHWLRQ7KHSURYLGHGZDUUDQW\VKDOOEHLQ DGGLWLRQWRDQGLQGHSHQGHQWIURPWKHURRIV\VWHPPDQXIDFWXUHU¶VZDUUDQW\7KH&RQWUDFWRUVKDOO DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±48$/,7<&21752/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW LQFOXGHODQJXDJHLQWKHZDUUDQW\VHWWLQJWKHPD[LPXPUHVSRQVHWLPHWRDZDUUDQW\FRPSODLQWE\WKH 2ZQHUWRKRXUVIRUHPHUJHQF\FRQGLWLRQVDQGILYHZRUNLQJGD\VIRUQRQHPHUJHQF\FRQGLWLRQV XQOHVVRWKHUZLVHDJUHHGXSRQE\WKH2ZQHU5HIHUWRVSHFLILFVHFWLRQVRIWKLVVSHFLILFDWLRQIRUDQ\ DGGLWLRQDOZDUUDQW\UHTXLUHPHQWV % ,QVWDOOURRILQJV\VWHPVWRDOORZIRULVVXDQFHRIPDQXIDFWXUHU¶VZDUUDQWLHVDVUHTXLUHGE\VSHFLILF VHFWLRQVRIWKHVHVSHFLILFDWLRQV & :KHQ VSHFLILHG LQ UHVSHFWLYH 6SHFLILFDWLRQ 6HFWLRQV DQGRU UHTXLUHG WR REWDLQ VSHFLILHG V\VWHP ZDUUDQW\ UHTXLUH WKH PDQXIDFWXUHU WR SURYLGH TXDOLILHG SHUVRQQHO WR REVHUYH ILHOG FRQGLWLRQV FRQGLWLRQVRIVXUIDFHVDQGLQVWDOODWLRQTXDOLW\RIZRUNPDQVKLSDVDSSOLFDEOHDQGWRPDNHDSSURSULDWH UHFRPPHQGDWLRQV$PLQLPXPRIYLVLWVWRWKHVLWHSOXVILQDOZDUUDQW\LQVSHFWLRQE\WKHURRI V\VWHPPDQXIDFWXUHU¶VtechnicalUHSUHVHQWDWLYHDUHUHTXLUHG5HSUHVHQWDWLYHVRIWKHPDQXIDFWXUHUVKDOO VXEPLW ZULWWHQ UHSRUWV REVHUYDWLRQV DQG UHFRPPHQGDWLRQV GXULQJILHOG VHUYLFHV $ FRS\ RI WKH PDQXIDFWXUHU¶VUHSRUWPXVWEHSURYLGHGWRWKH(QJLQHHUZLWKLQGD\VRIUHFHLSWE\WKH&RQWUDFWRU ' 6KRXOGZRUNPDQVKLSVDPSOHVRUVSHFLILFV\VWHPWHVWLQJEHUHTXLUHGE\WKHPDQXIDFWXUHULVVXLQJD ZDUUDQW\FRQWUDFWRUVKDOOSURYLGHVXFKWHVWLQJRUVDPSOLQJ,IIRUDQ\UHDVRQGHILFLHQFLHVDUHIRXQG ZLWKLQWKHV\VWHPGXULQJVDPSOLQJRUWHVWLQJWKH&RQWUDFWRUVKDOODWKLVH[SHQVHPDNHUHSDLUVDQG UHSODFHPHQWVDVQHFHVVDU\WRFRUUHFWGHILFLHQFLHVDQGVDWLVI\WKHUHTXLUHPHQWVRIWKHPDQXIDFWXUHU LVVXLQJWKHZDUUDQW\ 3$57352'8&761RW8VHG 3$57(;(&87,211RW8VHG (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &216758&7,21)$&,/,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 &216758&7,21)$&,/,7(6 3$57 *(1(5$/ 6,7(&21',7,216$1'35(-2%'$0$*(6859(< $7KH&RQWUDFWRULVWRDFFHSWWKHEXLOGLQJ³DVLV´DQGVKDOOH[HUFLVHFDUHWRSURWHFWH[LVWLQJXWLOLWLHV VLWHDQGEXLOGLQJFRPSRQHQWV9HULI\H[LVWLQJFRQGLWLRQVDQGQRWLI\2ZQHUDQG'HVLJQHUVKRXOG WKHFRQGLWLRQVYDU\VLJQLILFDQWO\IURPWKRVHGHVFULEHGLQWKHWHFKQLFDOVSHFLILFDWLRQVDQGGUDZLQJV 6KRXOG PLQRU FRQGLWLRQV EH HQFRXQWHUHG ZKLFK DUH QRW H[DFWO\ DV LQGLFDWHG PRGLILFDWLRQ WR DFFRPPRGDWHQHZZRUNVKDOOEHPDGHDVUHTXLUHGDWQRDGGLWLRQDOFRVWWRWKH2ZQHU %7KH&RQWUDFWRUVKDOOSHUIRUPDQGVXEPLWD3UH-RE'DPDJH6XUYH\WRGRFXPHQWH[LVWLQJFRQGLWLRQV DQGVSHFLILFGDPDJHVGHIHFWVWRH[LVWLQJEXLOGLQJRUEXLOGLQJFRPSRQHQWV3UH-RE'DPDJH6XUYH\ VKDOOEHSURYLGHGLQDFFRUGDQFHZLWK6HFWLRQRIWKHVHVSHFLILFDWLRQVDQGPXVWEHFRPSOHWHG SULRUWRWKHVWDUWRIVWDJLQJVWRUDJHRUPDWHULDOGHOLYHU\WRWKHVLWH 7(0325$5<)$&,/,7(6 $7HPSRUDU\:DWHU:DWHUIRUFRQVWUXFWLRQZLOOEHIXUQLVKHGE\WKH2ZQHUIURPH[LVWLQJIDFLOLWLHV LIH[WHULRUFRQQHFWLRQVDUHDYDLODEOHIXQFWLRQLQJDQGDGHTXDWHIRUXVH5HTXLUHGFRQQHFWLRQVDQG H[WHQVLRQVIRUWHPSRUDU\XVHVKDOOEHSURYLGHGE\WKH&RQWUDFWRUIURPDSRLQWGHVLJQDWHGE\WKH 2ZQHU7HPSRUDU\FRQQHFWLRQWRH[LVWLQJZDWHUPXVWEHWXUQHGRIIDQGGLVFRQQHFWHGZLWKQRWLQ XVHRUZKHQ&RQWUDFWRULVQRWRQVLWH$EXVHRIZDWHUSULYLOHJHVKDOOEHJURXQGVIRUFDQFHOODWLRQ RI VDPH E\ 2ZQHU &RQWUDFWRU ZLOO EH UHVSRQVLEOH IRU SURYLGLQJZDWHU LI H[LVWLQJ IDFLOLW\ FRQQHFWLRQVGRQRWH[LVWDUHQRWIXQFWLRQLQJRUDUHLQDGHTXDWHIRUWKHQHHGVRIWKH&RQWUDFWRU GXULQJWKHSURMHFW,ISURYLVLRQRIWHPSRUDU\ZDWHULVFULWLFDOWRLQVWDOODWLRQRUSURSHUHTXLSPHQW IXQFWLRQWKH&RQWUDFWRULVUHVSRQVLEOHIRUFRQILUPLQJH[LVWLQJDYDLODELOLW\SULRUWRELGGLQJDQG VKRXOGSURYLGHDVDSDUWRIKLVZRUNDQGZLWKLQKLV%DVH%LGDQ\VXSSOHPHQWDOZDWHUUHTXLUHGIRU SURSHULQVWDOODWLRQRIWKHZRUN %7HPSRUDU\3RZHU3RZHUIRUFRQVWUXFWLRQZLOOEHIXUQLVKHGE\WKH&RQWUDFWRUXQOHVVRWKHUZLVH DJUHHGXSRQE\WKH2ZQHU,IWKH2ZQHUDJUHHVWRSURYLGHWHPSRUDU\SRZHUDQGH[LVWLQJH[WHULRU SRZHUVXSSO\LVDGHTXDWHIRUUHTXLUHGHTXLSPHQWDQGLQVWDOODWLRQWKHUHTXLUHGFRQQHFWLRQVDQG H[WHQVLRQVIRUWHPSRUDU\XVHVKDOOEHSURYLGHGE\WKH&RQWUDFWRUIURPDSRLQWGHVLJQDWHGE\WKH 2ZQHU7KH&RQWUDFWRUVKDOOSURYLGHUHTXLUHGGLVWULEXWLRQER[HVJURXQGLQJUHTXLUHPHQWVDQG EUHDNHUSURWHFWLRQ&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHFRRUGLQDWLRQDQGFRVWRIDQ\UHTXLUHG LQVSHFWLRQ RI WHPSRUDU\ SRZHU FRPSRQHQWV $EXVH RI SRZHU SULYLOHJH VKDOO EH JURXQGV IRU FDQFHOODWLRQRIVDPHE\2ZQHU7KH&RQWUDFWRUPXVWSURYLGHDGHGLFDWHGJHQHUDWRUIRUXVHGXULQJ KHDWZHOGLQJRIWKHWKHUPRSODVWLFPHPEUDQHZLWKDQDXWRPDWLFURERWZHOGHU &7RLOHW )DFLOLWLHV 3URYLGH WHPSRUDU\ WRLOHW IDFLOLWLHV PHHWLQJWKH UHTXLUHPHQWV RI WKH +HDOWK 'HSDUWPHQWZLWKDXWKRULW\&RQWUDFWRU¶VSHUVRQQHOVKDOOQRWXVH2ZQHU¶VWRLOHWIDFLOLWLHV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &216758&7,21)$&,/,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW '6DQLWDU\)DFLOLWLHV3URYLGHWHPSRUDU\FRQWDLQHUVWRGLVSHQVHGULQNLQJZDWHUDQGJHQHUDOZDVKLQJ IDFLOLWLHV IRU FRQVWUXFWLRQSHUVRQQHO PHHWLQJ WKH UHTXLUHPHQWVRI WKH +HDOWK'HSDUWPHQW ZLWK DXWKRULW\&RQWUDFWRU¶VSHUVRQQHOVKDOOQRWXVH2ZQHU¶VUHVWURRPIDFLOLWLHV (([LVWLQJ8WLOLWLHV2QVLWHXQGHUJURXQGXWLOLWLHVVKDOOEHORFDWHGDQGPDUNHGE\DQLQGHSHQGHQW ORFDWLQJVHUYLFHDWWKH&RQWUDFWRU¶VH[SHQVH/RFDWLRQDQGPDUNLQJLVQHFHVVDU\LIH[FDYDWLRQZRUN ZLOOEHSHUIRUPHGRULIKHDY\HTXLSPHQWYHKLFOHRURWKHUFRQVWUXFWLRQWUDIILFZLOORFFXURYHU SRUWLRQVRIWKHVLWH&RQWUDFWRUVKDOOSD\IRUGDPDJHWRLQWHUUXSWLRQRIDQ\XWLOLW\VHUYLFHGXHWR FRQVWUXFWLRQDFWLYLWLHV $&&(66727+(6,7( $$FFHVVWRWKHVLWHDQGSDUNLQJPD\EHUHVWULFWHGWRVWRUDJHDQGVWDJLQJDUHDVDVGHVLJQDWHGRQWKH GHVLJQGUDZLQJVRUDVRWKHUZLVHUHTXLUHGE\WKH2ZQHU3URYLGHDOO&RQWUDFWRUHPSOR\HHVZLWK YLVLEOH LGHQWLILFDWLRQ EDGJHV VKLUWV RU KDUGKDWV EHDULQJ WKH QDPH RI WKH &RQWUDFWRU DQGRU HPSOR\HH(PSOR\HHVQRWGLVSOD\LQJLGHQWLILFDWLRQPD\EHUHTXLUHGWROHDYHWKHVLWH %&RQWUDFWRU¶V SHUVRQQHO VKDOO FRRUGLQDWH ZLWK WKH 2UDQJH &RXQW\$VVHW 0DQDJHPHQW SRLQW RI FRQWDFWSULRUWRSHUIRUPLQJZRUNRQWKHEXLOGLQJLQWHULRU&RQWUDFWRU¶VSHUVRQQHOVKDOORQO\ FRPPXQLFDWHZLWKGHVLJQDWHGSHUVRQQHODWWKHVLWH&RQGXFWE\WKH&RQWUDFWRU¶VSHUVRQQHOWKDW FDXVHVDQ\FRPSODLQWZLOOUHVXOWLQWKHSHUPDQHQWUHPRYDORIWKHRIIHQGLQJLQGLYLGXDOVIURPWKH VLWH 3527(&7,21$1'5(6725$7,21 $3HUIRUPD3UH-RE'DPDJH6XUYH\SULRUWRWKHVWDUWRIFRQVWUXFWLRQLQDFFRUGDQFHZLWK6HFWLRQ RI WKLV 3URMHFW 0DQXDO 3URWHFW H[LVWLQJ EXLOGLQJ DGMDFHQW EXLOGLQJV ZDONZD\V JUDVV DUHDV ODQGVFDSLQJSDYHGDQGFRQFUHWHSDUNLQJORWVEULFNSDYHUVDQGRWKHUVLWHIHDWXUHVDQGHTXLSPHQW IURP GDPDJH DV D UHVXOW RI FRQVWUXFWLRQ RSHUDWLRQV $Q\ GDPDJHG LWHPV RU FRQGLWLRQV QRW GRFXPHQWHGLQWKH3UH-RE'DPDJH6XUYH\WRKDYHEHHQH[LVWLQJSULRUWRWKHVWDUWRIFRQVWUXFWLRQ VKDOOEHFRQVLGHUHGWRKDYHEHHQGDPDJHGE\FRQVWUXFWLRQDFWLYLWLHVDQGVKDOOEHUHVWRUHGWRWKHLU RULJLQDO FRQGLWLRQ RU UHSODFHG DW QR FRVW WR WKH 2ZQHU :KHQHYHU GHPROLWLRQ SDWFKLQJ RU UHVWRUDWLRQLVUHTXLUHGIRUFRPSOHWLRQRIWKHZRUNSURYLGHSURWHFWLRQRIVLWHDQGEXLOGLQJIHDWXUHV UHJDUGOHVVRIEHLQJVKRZQRUQRWVKRZQRQWKHGUDZLQJV5HSDLURIJUDVVDUHDVZDONZD\V ODQGVFDSLQJDQGRWKHUVLWHIHDWXUHVGDPDJHGE\FRQVWUXFWLRQDFWLYLWLHVVKDOOEHSHUIRUPHGWRWKH VDWLVIDFWLRQRIWKH2ZQHUWRPHHWWKHFRQGLWLRQRIWKHIHDWXUHSULRUWRFRQVWUXFWLRQDFWLYLWLHV,WLV UHFRPPHQGHGWKDWWKH&RQWUDFWRUGLVFXVVH[SHFWDWLRQVIRUODQGVFDSLQJDQGJUDVVUHSDLUDQGRU VRGGLQJZLWKWKH2ZQHUGXULQJELGGLQJDQGSULRUWRWKHVWDUWRIZRUN %3URWHFWLQWHULRUILQLVKHVHTXLSPHQWDQGRWKHUEXLOGLQJXVHUSURSHUW\ORFDWHGLQVLGHWKHEXLOGLQJDV QHFHVVDU\&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUGDPDJHVUHVXOWLQJIURPFRQVWUXFWLRQDFWLYLWLHVLQFOXGLQJ GDPDJHVWRLQWHULRUILQLVKHV&RXQW\SURSHUW\DQGSHUVRQDOSURSHUW\RIEXLOGLQJRFFXSDQWVZLWKLQWKH EXLOGLQJ,QDUHDVZKHUHWKHXQGHUVLGHRIWKHURRIGHFNLVH[SRVHGWRWKHLQWHULRUWKH&RQWUDFWRUPXVW SODFHWHPSRUDU\SURWHFWLRQORRVHSODVWLFRYHULQWHULRUFRQWHQWVLQWKHDUHDVGLUHFWO\EHQHDWKWKHURRI DUHDWREHUHPRYHG3ODVWLFVKRXOGEHUHPRYHGDWWKHHQGRIWKHZRUNGD\ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &216758&7,21)$&,/,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW &3URYLGHWHPSRUDU\ZHDWKHUDQGGHEULVSURWHFWLRQDWDOOORFDWLRQVZKHUHH[LVWLQJEXLOGLQJPDWHULDOV DUHUHPRYHG&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUGDPDJHVUHVXOWLQJIURPLQDGHTXDWHSURWHFWLRQDQG HQWU\ RI ZDWHU GHEULV RU RWKHU LWHPV LQWR WKH LQWHULRU VSDFHV 5HIHU WR VSHFLILF URRI V\VWHP VSHFLILFDWLRQVHFWLRQVIRUDGGLWLRQDOUHTXLUHPHQWVIRUZHDWKHUWLJKWQHVVGXULQJFRQVWUXFWLRQ '3URYLGHEDUULHUVDURXQGWUHHVSODQWVDQGJURXQGPRXQWHGHTXLSPHQW7UHHSURWHFWLRQIHQFLQJPXVW EHLQVWDOOHGDWDOOWUHHVORFDWHGLQWKHJHQHUDOYLFLQLW\RIVWDJLQJDQGVWRUDJHDQWLFLSDWHGHTXLSPHQW WUDIILFURXWHVGXPSVWHUVDQGRWKHUFRQVWUXFWLRQDFWLYLWLHVXQOHVVRWKHUZLVHDJUHHGXSRQZLWKWKH 2ZQHU¶VUHSUHVHQWDWLYH3URWHFWWUHHVODQGVFDSLQJJUDVVDUHDVDQGRWKHUVLWHYHJHWDWLRQDJDLQVW YHKLFXODUWUDIILFVWRUHGPDWHULDOVFKHPLFDOO\LQMXULRXVPDWHULDOVDQGSXGGOLQJRUFRQWLQXRXV UXQQLQJZDWHU (&RPSO\ZLWK26+$DQGRWKHUDSSOLFDEOHVDIHW\UHJXODWLRQV&RQWUDFWRUVKDOOEHVROHO\UHVSRQVLEOH IRUWKHVDIHW\DQGKHDOWKRILWVHPSOR\HHV )3URYLGHWHPSRUDU\SURWHFWLRQDJDLQVWGDPDJHRIERWKVWRUHGDQGLQVWDOOHGSURGXFWV'DPDJHG PDWHULDOVRUSURGXFWVVKDOOEHUHPRYHGIURPWKHVLWHDQGUHSODFHGDWQRFRVWWRWKH2ZQHU */LPLW WUDIILF DQG VWRUDJH WR DUHDV ORFDWHG RQ WKH VLWH SODQ DQG DJUHHG XSRQ E\ WKH 2ZQHU¶V UHSUHVHQWDWLYHV +5RRIUHSODFHPHQWPXVWEHVHTXHQFHGWROLPLWIRRWDQGHTXLSPHQWWUDIILFRYHUDUHDVRIQHZURRI V\VWHPLQVWDOODWLRQ:KHUHIRRWDQGHTXLSPHQWWUDIILFRYHUWKHH[LVWLQJURRIV\VWHPLVXQDYRLGDEOH SURYLGHSURWHFWLYHZDONZD\VRURWKHUPHWKRGVWRDGHTXDWHO\SURWHFWWKHQHZPDWHULDOV7KH &RQWUDFWRU LV UHVSRQVLEOH IRU OHDNV LQ WKH H[LVWLQJ URRI V\VWHP FDXVHG E\ RU H[DFHUEDWHG E\ FRQVWUXFWLRQWUDIILF 6,7(&/($1,1* $&OHDQGHEULVIURPFRQVWUXFWLRQDFWLYLWLHVGDLO\DWPLQLPXPDQGGLUHFWO\IROORZLQJWKHHQGRID ZRUNVKLIW3ODFHGHEULVLQFORVHGFRQWDLQHUVIRUUHPRYDOIURPWKHVLWH %&OHDQXSVKDOOLQFOXGHUHPRYDORIPXGRLOVDQGGLUWWUDVKVFUDSGHEULVDQGH[FHVVPDWHULDOV IURPDQ\DUHDVRXWVLGHRIGHVLJQDWHGDQGEDUULFDGHGVWRUDJHDUHD &&OHDQLQJRIVLWHDQGUHPRYDORIGHEULVVKDOOEHWRWKHVDWLVIDFWLRQRIWKH2ZQHU:LQG\FRQGLWLRQV WKDWFDXVHEORZLQJRIPDWHULDOVRUGHEULVPD\UHTXLUHWKH&RQWUDFWRUWRSXWLQSODFHPRUHUHVWULFWLYH FOHDQLQJDQGSURWHFWLRQUHTXLUHPHQWV 6725$*($5($ $/LPLWHGVWRUDJHDQGVWDJLQJDUHDZLOOEHSURYLGHGRQVLWHDVVKRZQRQWKHSURMHFWGUDZLQJVDQG FRRUGLQDWHG ZLWK WKH 2ZQHU ,W LV WKH &RQWUDFWRU¶V UHVSRQVLELOLW\ WR DGHTXDWHO\ VHFXUH VWRUHG PDWHULDOVDQGHTXLSPHQW,QVWDOOFKDLQOLQNIHQFLQJDURXQGWKHPDLQVWDJLQJDQGPDWHULDOVWRUDJH DUHD)HQFLQJVKRXOGLQFOXGHQHFHVVDU\JDWHV&KDLQOLQNIHQFLQJLQVWDOOHGVKDOOEHDPLQLPXPRI ¶WDOOKDYHPRYDEOHEDVHVDQGVKDOOQRWEHLQVWDOOHGVXFKWKDWH[LVWLQJFRQFUHWHRUDVSKDOWVXUIDFHV DUHGDPDJHG$WLVRODWHGVWDJLQJDQGDFFHVVDUHDVSURYLGH¶WDOORUDQJHVQRZIHQFLQJVXUURXQGLQJ WKHSHULPHWHURIWKHDUHD)HQFLQJPXVWKDYHPRYDEOHEDVHVLIORFDWHGRQFRQFUHWHRUDVSKDOW DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 &216758&7,21)$&,/,7,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW $OWHUQDWHIHQFLQJPXVWEHGLVFXVVHGZLWKDQGDJUHHGXSRQE\WKH2ZQHU5HPRYHHYLGHQFHRIXVH DQGOHDYHDUHDDQGHQWLUHOLPLWVRIVLWHFOHDQXSRQFRPSOHWLRQRIWKHSURMHFW5HVWRUHDUHDVGDPDJHG E\VWRUHGPDWHULDOVWRRULJLQDOFRQGLWLRQ %&RQWUDFWRUVKDOOORDGPDWHULDOVRQWRWKHURRIZKHQDUHDVEHORZORDGLQJDUHDDUHXQRFFXSLHGE\ EXLOGLQJRFFXSDQWVXQOHVVRWKHUZLVHFRRUGLQDWHGZLWKWKH2ZQHU,WLVWKHUHVSRQVLELOLW\RIWKH &RQWUDFWRUWRVSDFHPDWHULDOVVWRUHGRQURRIVXFKWKDWWKH\GRQRWRYHUORDGWKHH[LVWLQJURRIGHFN DQGVWUXFWXUH6WRUDJHRIPDWHULDOVRQWKHURRIVXUIDFHVKDOOEHOLPLWHGWRWKRVHH[SHFWHGWREH LQVWDOOHGZLWKLQZRUNGD\VXQOHVVGLVFXVVHGZLWKDQGDJUHHGXSRQE\WKH2ZQHUDQG'HVLJQHU &&RQWUDFWRUVKDOOQRWVWRFNSLOHUHPRYHGPDWHULDOVRQVLWH '7KH&RQWUDFWRULVUHVSRQVLEOHIRUVFKHGXOLQJGHOLYHU\RIPDWHULDOVWRWKHVLWHWRDOORZIRUFRQWLQXHG ZRUNDQGWDNLQJLQWRFRQVLGHUDWLRQWKHVL]HDQGORFDWLRQRIVWRUDJHDUHD&RQWUDFWRUVKDOOREWDLQ DQGSD\IRUXVHRIDGGLWLRQDOVWRUDJHRUZRUNDUHDVLIQHHGHGIRURSHUDWLRQVXQGHUWKLV&RQWUDFW (1R&RQWUDFWRUVLJQRUDGYHUWLVHPHQWVKDOOEHDOORZHGWREHGLVSOD\HGZLWKRXWWKH2ZQHUDQG 'HVLJQHU¶VDSSURYDO 3$57 352'8&76±12786(' 3$57 (;(&87,21±12786(' (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±0$7(5,$/6$1'(48,30(17 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 0$7(5,$/6$1'(48,30(17 3$57 *(1(5$/ 75$163257$7,21$1'+$1'/,1* $3URYLGHHTXLSPHQWDQGSHUVRQQHOWRKDQGOHSURGXFWVE\PHWKRGVWRDYRLGSURGXFWGDPDJH'HOLYHU SURGXFWV LQ XQGDPDJHG FRQGLWLRQ LQ WKH PDQXIDFWXUHU¶V XQRSHQHGDQG PDUNHG FRQWDLQHUV RU SDFNLQJ %3URPSWO\LQVSHFWVKLSPHQWVWRDVVXUHWKDWSURGXFWVFRPSO\ZLWKVSHFLILHGUHTXLUHPHQWVTXDQWLWLHV DUHFRUUHFWDQGSURGXFWVDUHXQGDPDJHG 6725$*($1'3527(&7,21 $6WRUHSURGXFWVLQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU¶VLQVWUXFWLRQVZLWKVHDOVDQGODEHOVLQWDFWDQG OHJLEOH3URGXFWVUHTXLULQJILUHUHVLVWDQFHFODVVLILFDWLRQVKDOOEHGHOLYHUHGDQGVWRUHGZLWKODEHOV DWWDFKHGDQGSDFNDJHGDVUHTXLUHGE\ODEHOLQJ %)RUH[WHULRUVWRUDJHRISURGXFWVSODFHRQVORSHGVXSSRUWVDERYHWKHJURXQG&RYHUSURGXFWVZLWK LPSHUYLRXVVKHHWFRYHULQJDQGSURYLGHYHQWLODWLRQWRDYRLGFRQGHQVDWLRQ0DLQWDLQWHPSHUDWXUH DQGKXPLGLW\UDQJHVUHTXLUHGE\WKHPDQXIDFWXUHUIRUHDFKSURGXFW &6WRUHORRVHRUJUDQXODUPDWHULDOVRQVROLGVXUIDFHVLQDZHOOGUDLQHGDUHDDQGSUHYHQWPL[LQJZLWK IRUHLJQPDWWHU '$UUDQJHVWRUDJHWRSURYLGHDFFHVVIRULQVSHFWLRQ3HULRGLFDOO\LQVSHFWPDWHULDOVWRDVVXUHSURGXFWV DUHXQGDPDJHGDQGDUHPDLQWDLQHGXQGHUUHTXLUHGFRQGLWLRQV (6HOHFWDQGRSHUDWHPDWHULDOKDQGOLQJHTXLSPHQWVRDVQRWWRGDPDJHH[LVWLQJFRQVWUXFWLRQDQGRU PDWHULDOV3URWHFWPDWHULDOVDJDLQVWFRQVWUXFWLRQWUDIILF )0DWHULDOVWKDWDUHGDPDJHGRUWKDWEHFRPHVDWXUDWHGVKDOOQRWEHXVHGDQGVKDOOEHUHPRYHGIURP WKHSURMHFWVLWH7KH'HVLJQHUUHVHUYHVWKHULJKWWRPDUNGDPDJHGRUZHWPDWHULDOVDQGUHTXLUH LPPHGLDWHGLVSRVDOUHPRYDORIPDWHULDO *7KH&RQWUDFWRUVKDOOQRWORDGPRUHPDWHULDOVRQWKHURRIWKDQFDQEHLQVWDOOHGZLWKLQZRUNLQJ GD\VXQOHVVRWKHUZLVHDSSURYHG0DWHULDOVVKDOOEHGLVWULEXWHGDQGQRWVWDFNHG*DVROLQHVWRUDJH FRQWDLQHUVRSHQFOHDQHUVRURWKHUIODPPDEOHRUYRODWLOHPDWHULDOVVKDOOEHUHPRYHGIURPWKHURRI GDLO\ +3D\PHQWE\WKH2ZQHUIRUDQ\PDWHULDOVHTXLSPHQWRUODERULQFRUSRUDWHGLQWKHZRUNVKDOOQRWEH GHHPHGWREHDQDFFHSWDQFHE\WKH2ZQHU7KHULVNRIORVVRIVXFKPDWHULDOVHTXLSPHQWRUFRVWRI ODERUVSHQWWRLQVWDOOVXFKVKDOOUHPDLQZLWKWKH&RQWUDFWRU6WROHQGDPDJHGYDQGDOL]HGPLVVLQJ RU ZHDWKHUGDPDJHG HTXLSPHQW PDWHULDO DQG ZRUN VKDOO EH FRQVLGHUHG WKH SURSHUW\ RI WKH &RQWUDFWRUXQWLOILQDODFFHSWDQFHRIWKHSURMHFWE\WKH2ZQHU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±0$7(5,$/6$1'(48,30(17 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ,1RSD\PHQWE\WKH2ZQHUZLOOEHPDGHIRUDQ\PDWHULDOQRWSK\VLFDOO\ORFDWHGRQWKHVLWHXQOHVV WKHVWRUDJHRIVXFKPDWHULDOFDQEHYHULILHGE\WKH'HVLJQHUDQGLVPDUNHGVSHFLILFDOO\IRUWKH SURMHFWXVHDQGVFKHGXOHGIRULQVWDOODWLRQZLWKLQGD\VRISD\PHQWUHTXHVW 68%67,787,216$1'352'8&7237,216 $ 3URGXFWV6SHFLILHGE\5HIHUHQFH6WDQGDUGVRUE\'HVFULSWLRQ2QO\3URYLGHDSURGXFWPHHWLQJ WKRVHVWDQGDUGV7KH2ZQHUDQG(QJLQHHUUHVHUYHWKHULJKWWRUHTXLUHFRQILUPDWLRQE\WKHURRI PDQXIDFWXUHU WKDW WKHLU V\VWHPSURGXFWV LQWHQGHG IRU XVH PHHW WKH UHTXLUHPHQWV RI WKH VSHFLILFDWLRQV SULRU WR DZDUG RI WKH FRQWUDFW )DLOXUH RI WKHFRQWUDFWRU WR SURYLGH UHTXHVWHG FRQILUPDWLRQPD\UHVXOWLQGLVTXDOLILFDWLRQRIWKHLUELG % 3URGXFWV6SHFLILHGE\1DPLQJ6HYHUDO0DQXIDFWXUHUV3URYLGHDSURGXFWRIQDPHGPDQXIDFWXUHUV PHHWLQJ VSHFLILFDWLRQV 5HTXHVWV IRU SURGXFW VXEVWLWXWLRQV PXVW EH PDGH LQ ZULWLQJ IRU DQ\ PDQXIDFWXUHUQRWVSHFLILFDOO\QDPHGLQDFFRUGDQFHZLWKWKHIROORZLQJUHTXLUHPHQWVLQSDUDJUDSKV &'()DQG*:KHQDPLQLPXPRIWKUHHDSSURYHGPDQXIDFWXUHUVSURGXFWVDUHOLVWHG WKH (QJLQHHU UHVHUYHV WKH ULJKW WR QRW DFFHSW DQ\ UHTXHVWV IRUPDQXIDFWXUHUV\VWHP VXEVWLWXWLRQV & ,IWKH(QJLQHHUZLOODOORZUHTXHVWVIRUVXEVWLWXWLRQRIWKHURRIPHPEUDQHV\VWHPDQGPDQXIDFWXUHU IURPWKRVHOLVWHGLQWKHDSSOLFDEOHVHFWLRQRIWKHVHVSHFLILFDWLRQVUHTXHVWVPXVWEHVXEPLWWHGQR OHVVWKDQWHQGD\VSULRUWRWKHELGGDWH5HTXHVWVPXVWEHPDGHE\WKH&RQWUDFWRUUHTXHVWV IURPVXSSOLHUVRUPDQXIDFWXUHUVZLOOQRWEHUHYLHZHG '(DFK ZULWWHQ UHTXHVW IRU D VXEVWLWXWLRQ VKDOO EH VXEPLWWHG ZLWK FRPSOHWH GDWD VXEVWDQWLDWLQJ FRPSOLDQFHRISURSRVHGVXEVWLWXWLRQZLWKWKHWHFKQLFDOVSHFLILFDWLRQVDQGGUDZLQJV (7KHUHTXHVWVKDOOFRQVWLWXWHWKDWWKH&RQWUDFWRU +DVLQYHVWLJDWHGWKHSURSRVHGSURGXFWDQGGHWHUPLQHGWKDWLWPHHWVRUH[FHHGVLQDOO UHVSHFWVVSHFLILHGSURGXFWDQGSURYLGHGGRFXPHQWDWLRQWR(QJLQHHU :LOOSURYLGHWKHVDPHZDUUDQW\DVWKHVSHFLILHGSURGXFW :LOOFRRUGLQDWHLQVWDOODWLRQDQGPDNHDQ\RWKHUFKDQJHWKDWPD\EHUHTXLUHGIRUZRUNWR EHFRPSOHWHZLWKVXEVWLWXWHGLWHP :DLYHVFODLPVIRUDGGLWLRQDOFRVWVWKDWPD\VXEVHTXHQWO\EHFRPHDSSDUHQWGXHWRXVHRI VXEVWLWXWHGLWHP )6XEVWLWXWLRQVZLOOQRWEHFRQVLGHUHGZKHQWKH\DUHLQFOXGHGZLWKRXWLGHQWLILFDWLRQDVDVXEVWLWXWLRQ RULPSOLHGRQVKRSGUDZLQJVRUSURGXFWGDWDVXEPLWWDOVZLWKRXWVHSDUDWHZULWWHQUHTXHVWRUZKHQ DFFHSWDQFHZLOOUHTXLUHVXEVWDQWLDOUHYLVLRQRIWHFKQLFDOVSHFLILFDWLRQV *7KH'HVLJQHUZLOOGHWHUPLQHDFFHSWDELOLW\RISURSRVHGVXEVWLWXWLRQDQGZLOOQRWLI\WKH&RQWUDFWRU RIDFFHSWDQFHRUUHMHFWLRQLQZULWLQJZLWKLQDUHDVRQDEOHWLPH 3$57 352'8&76±12786(' 3$57 (;(&87,21±12786(' (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±352-(&7&/26(287 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 352-(&7&/26(287 3$57*(1(5$/ 6800$5< $ :KHQ &RQWUDFWRU FRQVLGHUV :RUN WR KDYH UHDFKHG FRPSOHWLRQ VXEPLW ZULWWHQ FHUWLILFDWLRQ WKDW &RQWUDFW 'RFXPHQWVKDYH EHHQ UHYLHZHGWKH &RQWUDFWRUKDV LQVSHFWHG :RUN DQG WKDW :RUNLV FRPSOHWHLQDFFRUGDQFHZLWK&RQWUDFW'RFXPHQWVDQGUHDG\IRU(Q JLQHHU VLQVSHFWLRQ)RUWKHSXUSRVH RIUHTXHVWLQJDSUHILQDOLQVSHFWLRQ³FRPSOHWLRQ´LVGHILQHGDVWKHSHUIRUPDQFHRIDOORIWKHZRUNLWHPV OLVWHGLQWKH3URMHFW0DQXDODQGDVUHTXLUHGIRUSURSHULQVWDOODWLRQRIWKHURRIV\VWHP % 'HVLJQHUVKDOOPDNHRQHSUHILQDOLQVSHFWLRQGXULQJZKLFKDOLVWRILQFRPSOHWHLWHPVRULWHPVUHTXLULQJ UHSDLUSXQFKOLVWZLOOEHFRPSLOHG8SRQFRPSOHWLRQRISXQFKOLVWLWHPVWKH&RQWUDFWRUVXEPLWLQ ZULWLQJWKDWFRPSOHWLRQRIWKHSXQFKOLVWLWHPVKDVEHHQFRQILUPHGE\WKH&RQWUDFWRUDQGLVUHDG\IRU WKH'HVLJQHU¶VILQDOLQVSHFWLRQ7KH'HVLJQHUZLOOSHUIRUPWKH)LQDO,QVSHFWLRQWRFRQILUPFRPSOHWLRQ RIRXWVWDQGLQJSXQFKOLVWLWHPV & ,IWKH&RQWUDFWRUIDLOVWRFRPSOHWHFRQWUDFWRQWLPHWKH2ZQHUUHVHUYHVWKHULJKWWRDVVHVVOLTXLGDWHG GDPDJHVLQDFFRUGDQFHZLWKWKH6XSSOHPHQWDU\&RQGLWLRQVRIWKH&RQWUDFW ' ,IWKH&RQWUDFWRUIDLOVWRFRPSOHWHFRQWUDFWRQWLPHDGGLWLRQDOUHVWULFWLRQVIURPWKH2ZQHUWRZRUN VFKHGXOHQRLVHVWRUDJHVWDJLQJDQGRWKHUVLWHDQGEXLOGLQJUHVWULFWLRQVPD\DSSO\ ( ,QDGGLWLRQWRSRVWMREVXEPLWWDOVUHTXLUHGE\6HFWLRQSURYLGHDQ\VXEPLWWDOVUHTXLUHGE\ JRYHUQLQJDXWKRULWLHVDQGVXEPLWDILQDOVWDWHPHQWRIDFFRXQWLQJJLYLQJWRWDODGMXVWHG&RQWUDFW6XP SUHYLRXVSD\PHQWVDQGVXPUHPDLQLQJGXH )'HVLJQHU ZLOO LVVXH D ILQDO &KDQJH 2UGHU UHIOHFWLQJ DSSURYHG DGMXVWPHQWV WR &RQWUDFW 6XP QRW SUHYLRXVO\PDGHE\&KDQJH2UGHU ),1$/&/($1,1* $ ([HFXWHILQDOFOHDQLQJRIWKHURRIPHPEUDQHVXUIDFHDQGDOOFRPSRQHQWVSULRUWRSHUIRUPDQFHRIWKH 3UH)LQDOLQVSHFWLRQ([HFXWHILQDOFOHDQLQJRIWKHVLWHDQGSXQFKOLVWUHSDLUDUHDVSULRUWRUHTXHVWLQJ WKHILQDOLQVSHFWLRQ % &OHDQLQWHULRUDQGH[WHULRUVXUIDFHVH[SRVHGWRYLHZUHPRYHWHPSRUDU\ODEHOVVWDLQVDQGIRUHLJQ VXEVWDQFHV & &OHDQVLWHVZHHSSDYHGDUHDVUDNHFOHDQRWKHUVXUIDFHVDIIHFWHGE\WKHZRUNVWRUDJHRUDFFHVV &RQWUDFWRUPD\EHUHTXLUHGWRUHVRGDUHDVRIJUDVVWKDWDUHNLOOHGGDPDJHGDVDUHVXOWRIFRQVWUXFWLRQ DFWLYLW\LIUHTXLUHGE\WKH2ZQHUWRUHWXUQVLWHFRQGLWLRQVWRWKHLURULJLQDOFRQGLWLRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±352-(&7&/26(287 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ' 5HPRYHZDVWHDQGVXUSOXVPDWHULDOVUXEELVKDQGFRQVWUXFWLRQIDFLOLWLHVIURPWKH3URMHFWDQGIURP WKHVLWH 352-(&75(&25''2&80(176 $ .HHSDUHFRUGGRFXPHQWVHWRQVLWHVWRUHGIRUSURWHFWLRQIURPFRQVWUXFWLRQDFWLYLW\ % .HHS UHFRUG GRFXPHQWV FXUUHQW GR QRW SHUPDQHQWO\ FRQFHDO DQ\ FKDQJHG ZRUN XQWLO UHTXLUHG LQIRUPDWLRQKDVEHHQUHFRUGHG & $W&RQWUDFWFORVHRXWVXEPLWUHFRUGGRFXPHQWVDVEXLOWGUDZLQJVDVLQGLFDWHGLQ6HFWLRQ ZLWKWUDQVPLWWDOOHWWHUFRQWDLQLQJGDWH3URMHFWWLWOH&RQWUDFWRU VQDPHDQGDGGUHVVOLVWRIGRFXPHQWV DQGVLJQDWXUHRI&RQWUDFWRU5HFRUGGUDZLQJVZLWKKDQGZULWWHQUHGOLQHPDUNXSVDUHDFFHSWDEOHIRU VXEPLWWDOWRIXOILOOWKLVUHTXLUHPHQW 23(5$7,21$1'0$,17(1$1&('$7$ $ 3URYLGHGDWDIRUURRIV\VWHPVDQGRWKHULQVWDOOHGHTXLSPHQWLQDFFRUGDQFHZLWK6HFWLRQ :$55$17,(6$1'%21'6 $ 3URYLGHUHTXLUHGFRQWUDFWRUDQGPDQXIDFWXUHU¶VZDUUDQWLHVLQDFFRUGDQFHZLWK6HFWLRQ 3$57352'8&761RW8VHG 3$57(;(&87,211RW8VHG (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6(/(&7,9('(02/,7,21 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 6(/(&7,9('(02/,7,21 3$57 *(1(5$/ :25.,1&/8'(' $3HUIRUPD3UH-RE'DPDJH6XUYH\SULRUWRWKHVWDUWRIZRUNRQVLWHLQFOXGLQJPRELOL]DWLRQRI HTXLSPHQWPDWHULDOGHOLYHU\DQGVHWXSRIVWRUDJHDQGVWDJLQJDUHDV %:DWHUWHVWLQWHUQDOURRIGUDLQVSULRUWRWKHVWDUWRIGHPROLWLRQIRUURRIUHSODFHPHQWWRFRQILUPWKDW WKH\DSSHDUWREHLQZRUNLQJRUGHUQRWFORJJHGRUGDPDJHGLQDZD\WKDWFDXVHVWKHEDFNXSRU VORZIORZRIGUDLQLQJZDWHU5HPRYHYLVLEOHGHEULVIURPWKHGUDLQERZODQGOHDGHU1RWLI\WKH 'HVLJQHUDQG2ZQHULIZDWHUWHVWLQJLQGLFDWHVDEORFNDJHRUGDPDJHEH\RQGWKHYLVLEOHSRUWLRQRI WKHGUDLQOHDGHUV &&RQILUPZRUNLQJRUGHURIPHFKDQLFDOXQLWVORFDWHGRQWKHURRIDVDSDUWRIWKH3UH-RE'DPDJH 6XUYH\ '3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\WRSHUIRUPVHOHFWLYHGHPROLWLRQ ZKLFKLQFOXGHVEXWLVQRWOLPLWHGWRWKHIROORZLQJ D5HPRYHWKHH[LVWLQJVLQJOHSO\URRIPHPEUDQHLQVXODWLRQIODVKLQJVHGJHPHWDODQGDFFHVVRULHV GRZQWRWKHH[LVWLQJJ\SVXPERDUG$UHD$RUPHWDOGHFN$UHD%DQGGLVSRVHRIRIIVLWH'LVSRVH RIPDWHULDOVRIIVLWHXQOHVVRWKHUZLVHFRRUGLQDWHGZLWKWKH2ZQHU E,QVSHFWWKHH[SRVHGH[LVWLQJSHULPHWHUEORFNLQJDQGUHPRYHEORFNLQJFRPSRQHQWVDVUHTXLUHGWR SURSHUO\LQVWDOOWKHQHZURRIV\VWHPGHWDLOV,IH[LVWLQJZRRGEORFNLQJRUSO\ZRRGQRWHGWRUHPDLQ LVGDPDJHGRUGHWHULRUDWHGUHSDLUUHSODFHWKHEORFNLQJRUSO\ZRRGLQDFFRUGDQFHZLWK6HFWLRQ F,QVSHFWWKHH[LVWLQJWKHUPDOEDUULHUDQGURRIGHFNDQGPDNHUHSDLUVZKHUHGDPDJHGHWHULRUDWLRQLV REVHUYHGLQDFFRUGDQFHZLWK6HFWLRQ G3URYLGH PHFKDQLFDO HOHFWULFDO SOXPELQJ DQG RWKHU VHUYLFHV DV QHHGHG WR DFFRPSOLVK GLVFRQQHFWLRQUHFRQQHFWLRQPRGLILFDWLRQUHFKDUJLQJRUH[WHQVLRQRIXWLOLW\RUFRQWUROVHUYLFHV LQFOXGLQJGXFWZRUNDWDQ\URRIPRXQWHGHTXLSPHQWDVVRFLDWHGZLWKOLIWLQJUDLVLQJRUPRGLI\LQJ WRDFFHSWWKHQHZURRIV\VWHP&RRUGLQDWHZLWKWKHIDFLOLW\PDLQWHQDQFHVWDIIWRVFKHGXOHWHPSRUDU\ VKXWGRZQRIWKHXQLWVDQGWRSUHYHQWGDPDJHWRWKHXQLWV8SRQFRPSOHWLRQRIZRUNFRQILUPSURSHU ZRUNLQJRUGHUZLWKWKH2ZQHU (3URWHFWFRPSRQHQWVWKDWZLOOUHPDLQIRUUHXVHLQFOXGLQJEXWQRWOLPLWHGWRH[LVWLQJSO\ZRRGDQG EORFNLQJH[LVWLQJURRIV\VWHPPHPEUDQHURRIGHFNDQGVWUXFWXUHH[WHULRUZDOOVSLSHYHQWVDQG GRZQVSRXWERRWFRQQHFWLRQVWRXQGHUJURXQGGUDLQDJHOLQHVOLJKWZHOOVN\OLJKWHWFGXULQJUHPRYDO RIWKHUHTXLUHGV\VWHPFRPSRQHQWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6(/(&7,9('(02/,7,21 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW )3URYLGHRWKHUGHPROLWLRQZKHWKHURUQRWLQGLFDWHGRQWKHGUDZLQJVRULQWKHVSHFLILFDWLRQVDV UHTXLUHGWRSHUIRUPSURSHULQVWDOODWLRQRIWKHVSHFLILHGURRIV\VWHPDQGDVVRFLDWHGFRPSRQHQWV 35(-2%'$0$*(6859(< $&RQWUDFWRUVKDOOSHUIRUPDSUHMREGDPDJHVXUYH\RIWKHURRIWRSHTXLSPHQWDQGIHDWXUHVEXLOGLQJ H[WHULRUVLWHSDYHPHQWVDQGEXLOGLQJLQWHULRUWRGRFXPHQWH[LVWLQJGDPDJHGFRQGLWLRQVSULRUWR EHJLQQLQJZRUN %&RQWUDFWRUVKDOOVXEPLWUHTXLUHGGRFXPHQWDWLRQLQFOXGLQJHLWKHUYLGHRWDSHIRRWDJHRIWKHVXUYH\ DQGRUSKRWRJUDSKVDQGVNHWFKHVDVQHFHVVDU\WRDGHTXDWHO\GHVFULEHWKHORFDWLRQRIH[LVWLQJ FRQGLWLRQVDQGGHIHFWVDQGWRYHULI\WKHGDWHRIWKHVXUYH\ &7KH2ZQHUDQGRU(QJLQHHUZLOOQRWUHYLHZDQGDSSURYHLWHPVGRFXPHQWHGLQWKH&RQWUDFWRU¶VSUH MREGDPDJHVXUYH\XQOHVVVSHFLILFDOO\UHTXHVWHGE\WKH&RQWUDFWRU '7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUUHSDLURUUHSODFHPHQWRIPDWHULDOVWKDWDUHGDPDJHGGXULQJ FRQVWUXFWLRQDFWLYLWLHVDQGDUHQRWGRFXPHQWHGWRKDYHEHHQH[LVWLQJSULRUWREHJLQQLQJWKHZRUN ,WHPVPDWHULDOVWKDWDUHGDPDJHGVKDOOEHUHWXUQHGWRWKHLURULJLQDOFRQGLWLRQSULRUWRFRQVWUXFWLRQ DFWLYLWLHV ,I UHWXUQ WR RULJLQDO FRQGLWLRQ LV QRW SRVVLEOHSUDFWLFDO &RQWUDFWRU VKDOO UHSODFH LWHPPDWHULDOZLWKQHZDVDSSURYHGE\WKH(QJLQHHUDQGWKH2ZQHU 3527(&7,21 $ /LPLWVL]HRIZRUNVHFWLRQVWRVDIHJXDUGDGMDFHQWPDWHULDOVVWUXFWXUHVHWFDQGWRPLQLPL]HGXVW QRLVHDQGZDWHUGDPDJH % 3URWHFWH[LVWLQJVLWHDQGIDFLOLWLHVIURPGDPDJHGXULQJZRUN'RQRWRYHUORDGH[LVWLQJSDYLQJ FXUEVVLGHZDONVHWFZLWKYHKLFOHWUDIILF'RQRWRYHUORDGQHZRUH[LVWLQJFRQVWUXFWLRQZLWK GHPROLWLRQGHEULVHTXLSPHQWHWF & 0DWHULDODQGGHEULVVKDOOEHWUDQVSRUWHGWRDQGIURPWKHURRIE\FUDQHKRLVWRUIRUNOLIW7KH HTXLSPHQWVKDOOEHRSHUDWHGE\DFHUWLILHGRSHUDWRU ' 'DPDJHVKDOOEHUHSDLUHGDWWKH&RQWUDFWRU VH[SHQVH ( &RQWUDFWRUVKDOOIXUQLVKQHFHVVDU\WHPSRUDU\SURWHFWLRQIURPZHDWKHUDWDOODUHDVRIGHPROLWLRQWR SURWHFWLQWHULRURIEXLOGLQJIURPHOHPHQWVRIZHDWKHUDWDOOWLPHV,QVWDOOVSHFLILHGURRIV\VWHPV DQGWLHLQWRH[LVWLQJURRIV\VWHPDVQHHGHGWRPDNHURRIZDWHUWLJKWGDLO\ ) 'HEULVZLOOQRWEHDOORZHGWRDFFXPXODWHRQWKHURRIRURQVLWH'HEULVVKDOOEHUHPRYHGIURPWKH URRIGDLO\ * 7KH&RQWUDFWRUVKDOOQRWORDGPRUHPDWHULDOVRQWKHURRIWKDQFDQEHLQVWDOOHGWKDWGD\XQOHVV RWKHUZLVHDSSURYHGE\WKH2ZQHURU2ZQHU¶VUHSUHVHQWHG0DWHULDOVVKDOOEHGLVWULEXWHGDQGQRW VWDFNHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6(/(&7,9('(02/,7,21 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 3$57 352'8&76 $ 0HWDO 'HFN 5HSODFHPHQW 6KDOO PDWFK H[LVWLQJ SURILOH JDXJH W\SH DQG PHHW $670 $ GHVLJQDWLRQ*JDOYDQL]HGDQGFRDWHGRQERWKVLGHVRIVKHHW % 0HWDO'HFN5HSDLU6KDOOEHDPLQLPXPRIOD\HUVRIJDXJHJDOYDQL]HGVWHHOVKHHW & )DVWHQHUV0HWDO'HFN6KDOOEHFRUURVLRQUHVLVWDQWVHOIWDSSLQJKH[KHDGVFUHZV ' 0HWDO'HFN5HVWRUDWLRQZLWK5XVW,QKLELWRU 6KDOOEHVLPLODUWR5XVW2/HXPPHWDOSULPHU 3$57 (;(&87,21 35(-2%'$0$*(6859(< $ &RQWUDFWRUVKDOOSHUIRUPDSUHMREGDPDJHVXUYH\RIWKHH[LVWLQJURRIWRSDQGVLWHFRPSRQHQWV LQFOXGLQJURRIEXLOGLQJH[WHULRUVZDONZD\VSDYHUVSDYHPHQWVVLWHIHDWXUHVODQGVFDSLQJJUDVV DQGEXLOGLQJLQWHULRUILQLVKHVWRGRFXPHQWH[LVWLQJGDPDJHGFRQGLWLRQVSULRUWREHJLQQLQJZRUN,W LVUHFRPPHQGHGWKDWWKH&RQWUDFWRUFRRUGLQDWHZLWKWKH2ZQHU¶VUHSUHVHQWDWLYHWRKDYHWKHFXUUHQW ZRUNLQJFRQGLWLRQRIDQ\URRIPRXQWHGHTXLSPHQWIDQVWRUHPDLQFRQILUPHGDVDSDUWRIWKH3UH 'DPDJH6XUYH\ % &RQWUDFWRUVKDOOVXEPLWUHTXLUHGGRFXPHQWDWLRQLQFOXGLQJHLWKHUYLGHRWDSHIRRWDJHRIWKHVXUYH\ DQGRUSKRWRJUDSKVDQGVNHWFKHVDVQHFHVVDU\WRDGHTXDWHO\GHVFULEHH[LVWLQJFRQGLWLRQVDQGWR DOORZIRUWKHORFDWLRQRIQRWHGGHIHFWV,IQRWLPHVWDPSLVSURYLGHGRQGRFXPHQWVLWLVFULWLFDOWKDW WKH&RQWUDFWRUVXEPLWWKH3UH-RE'DPDJH6XUYH\WRWKH(QJLQHHUSULRUWRWKHVWDUWRIZRUN9LGHR RIWKHH[LVWLQJFRQGLWLRQVLVDFFHSWDEOHDVORQJDVWKHIRRWDJHLVQDUUDWHGWRGHVFULEHFRQGLWLRQV REVHUYHGDQGIRRWDJHLVWDNHQDWWKHSURSHUGLVWDQFHDQGIRFXVWRPDNHGHVFULEHGFRQGLWLRQVYLVLEOH &,WVKDOOQRWEHWKHUHVSRQVLELOLW\RIWKH2ZQHUDQGRU(QJLQHHUWRUHYLHZRUDSSURYHWKHFRQWHQWVRI WKH&RQWUDFWRU¶V3UH-RE'DPDJH6XUYH\7KHFRQWUDFWRUPD\UHTXHVWWKDWWKH(QJLQHHURU2ZQHU DFFRPSDQ\WKHPWRREVHUYHDVSHFLILFFRQGLWLRQLIWKHUHDUHTXHVWLRQVRUDGHTXDWHGRFXPHQWDWLRQ E\YLGHRRUSKRWRJUDSKVPD\QRWEHIHDVLEOH '7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUUHSDLURUUHSODFHPHQWRIPDWHULDOVWKDWDUHGDPDJHGGXULQJ FRQVWUXFWLRQDFWLYLWLHVDQGZHUHQRWGRFXPHQWHGZLWKLQWKH3UH-RE'DPDJH6XUYH\WRKDYHEHHQ GDPDJHGSULRUWREHJLQQLQJWKHZRUN,WHPVPDWHULDOVWKDWDUHGDPDJHGVKDOOEHUHWXUQHGWRWKH FRQGLWLRQWKH\ZHUHLQSULRUWRFRQVWUXFWLRQDFWLYLWLHV,IUHWXUQWRSUHFRQVWUXFWLRQFRQGLWLRQLVQRW SRVVLEOHSUDFWLFDO &RQWUDFWRU VKDOO UHSODFH LWHPPDWHULDO ZLWK QHZ WR WKH VDWLVIDFWLRQ RI WKH (QJLQHHUDQG2ZQHU '(02/,7,21 $:DWHUWHVWGUDLQOLQHVLQFRQMXQFWLRQZLWKWKH3UH-RE'DPDJH6XUYH\7KHSXUSRVHRIWKHWHVWLV WRFRQILUPWKDWZDWHUIORZVIUHHO\LQWRWKHGUDLQOLQHVZLWKRXWHYLGHQFHRIFORJJLQJRUEDFNXSSULRU WRWKHVWDUWRIGHPROLWLRQZRUN2QHGUDLQKDVEHHQLGHQWLILHGWREHFORJJHGDQGWKLVGUDLQVKRXOG EHFOHDQHGWRDOORZIRUGUDLQDJHRIZDWHUDVDSDUWRIWKHWHVWLQJ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6(/(&7,9('(02/,7,21 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW %1RWLI\WKH(QJLQHHUDQG2ZQHURIVXVSHFWHGRUREVHUYHGGDPDJHFORJJLQJRIGUDLQDJHOHDGHUVQRW DOUHDG\LGHQWLILHG &'HPROLVKLQGLFDWHGDUHDVLQDQRUGHUO\DQGFDUHIXOPDQQHU3URWHFWH[LVWLQJVWUXFWXUDOPHPEHUV ',QVSHFWH[LVWLQJURRIGHFNZKHUHH[SRVHG1RWLI\2ZQHU2ZQHU¶VUHSUHVHQWDWLYHRIDUHDVRI GHWHULRUDWHGFRUURGHGRUGDPDJHGGHFN (7KH2ZQHU¶VUHSUHVHQWDWLYHRU'HVLJQHUDQG&RQWUDFWRUVKDOOGRFXPHQWWKHDFWXDOTXDQWLW\RI DOORZDQFHZRUNXVHG,IWKH2ZQHU¶VUHSUHVHQWDWLYHRU'HVLJQHULVQRWDYDLODEOHDSKRWRJUDSKRI WKHPDWHULDOWREHUHSODFHGPXVWEHWDNHQDQGWKHPDWHULDOVHWDVLGHIRUREVHUYDWLRQ7KH&RQWUDFWRU VKDOOQRWEHUHLPEXUVHGIRUDQ\PDWHULDOQRWYHULILHGSURSHUO\ )'HFNRUVXEVWUDWHFRQILUPHGWREHGDPDJHGVKDOOEHUHSODFHGRUUHSDLUHGSULRUWRLQVWDOOLQJQHZ URRIV\VWHP5HSODFHGDPDJHGGHFNRUVXEVWUDWHZLWKQHZPDWHULDORISURILOHVL]HDQGW\SHWR PDWFKH[LVWLQJDVFORVHO\DVSRVVLEOH *'RQRWUHPRYHPRUHH[LVWLQJURRIV\VWHPPDWHULDOVWKDQFDQEHUHSODFHGZLWKQHZPDWHULDOVWRD ZDWHUWLJKWFRQGLWLRQE\WKHHQGRIWKHVDPHZRUNGD\&RQWUDFWRUVKDOOKDYHUHDG\QHFHVVDU\ WHPSRUDU\SURWHFWLRQIURPZHDWKHUDWDOODUHDVRIGHPROLWLRQWRSURWHFWLQWHULRURIEXLOGLQJIURP HOHPHQWVLQWKHHYHQWRIXQH[SHFWHGLQFOHPHQWZHDWKHU +&HDVHRSHUDWLRQVDQGQRWLI\WKH2ZQHULPPHGLDWHO\LIDGMDFHQWEXLOGLQJVILQLVKHVRUVWUXFWXUHV DSSHDUWREHHQGDQJHUHG'RQRWUHVXPHRSHUDWLRQVXQWLOFRUUHFWLYHPHDVXUHVKDYHEHHQWDNHQ ,&OHDQDOOGXVWDQGGHEULVIURPWKHH[SRVHGVXEVWUDWH'HEULVZLOOQRWEHDOORZHGWRDFFXPXODWHRQ WKHURRIVXUIDFHDQGPXVWEHUHPRYHGIURPWKHURRIGDLO\0DWHULDODQGGHEULVVKDOOEHWUDQVSRUWHG WRDQGIURPWKHURRIE\FUDQHKRLVWRUIRUNOLIWXQOHVVRWKHUZLVHDSSURYHGE\WKH(QJLQHHURU2ZQHU ,IFUDQHLVXVHGLWVKDOOEHRSHUDWHGE\DFHUWLILHGFUDQHRSHUDWRU -3URYLGHZLQGVFUHHQVRURWKHUSURWHFWLRQDVQHFHVVDU\WRSUHYHQWZLQGEORZQGHEULVIURPWKHURRI VXUIDFHRUIURPGXPSVWHUV .'UDJDPDJQHWRQWKHJURXQGGDLO\WRUHPRYHWKHIDVWHQHUVDQGPHWDOSLHFHV'LVSRVHRIDOOGHEULV GDLO\ /'HEULVPXVWEHUHPRYHGIURPWKHVLWHGDLO\XQOHVVHQFORVHGE\DGXPSVWHUWUDLOHURURWKHUVLGHG FRQWDLQHUWKDWFDQEHFRYHUHGLIQHFHVVDU\WRSUHYHQWEORZLQJGHEULV'RQRWVWRFNSLOHPDWHULDOV RQWKHVLWHXQOHVVDJUHHGXSRQZLWKWKH2ZQHU¶VUHSUHVHQWDWLYH'RQRWEXUQRUEXU\PDWHULDOVRQ VLWH 0&RQWUDFWRUVKDOODFTXLUHUHSDLUPDWHULDOVRQVLWHSULRUWRVWDUWRIGHPROLWLRQWRDYRLGGHOD\LQUHSDLUV 1(VWLPDWHG TXDQWLWLHV RI ZRUN DUH LQFOXGHG LQ WKH %DVH %LG SHU 6HFWLRQ IRU H[LVWLQJ FRPSRQHQWV WKDW PD\ UHTXLUH UHSDLUUHSODFHPHQW $W SURMHFW FRPSOHWLRQ RU FRPSOHWLRQ RI SDUWLFXODUSURMHFWPLOHVWRQHVWKHDFWXDOTXDQWLWLHVZRUNSHUIRUPHGZLOOEHFRPSDUHGZLWKWKH HVWLPDWHGTXDQWLWLHVWRGHWHUPLQHLIFKDQJHVWRWKHFRQWUDFWVXPDGGLWLRQRUGHGXFWPD\EH UHTXLUHG7RHQVXUHWKDWDFFXUDWHTXDQWLWLHVRIZRUNSHUIRUPHGDUHLQFOXGHGLQWKLVFRPSDULVRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±6(/(&7,9('(02/,7,21 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW WKH&RQWUDFWRUPXVWSURYLGHVSHFLILFGRFXPHQWDWLRQRIZRUNW\SHTXDQWLWLHVDQGFRQILUPDWLRQWKDW ZRUNZDVZDUUDQWHG'RFXPHQWDWLRQFDQLQFOXGHUHYLHZRIH[LVWLQJFRQGLWLRQVRUZRUNSHUIRUPHG SULRUWRFRYHULQJE\WKH&RQWUDFWRUDQG(QJLQHHURU2ZQHU¶VUHSUHVHQWDWLYHZLWKDJUHHGXSRQ TXDQWLWLHVSKRWRJUDSKHGDQGGRFXPHQWHGLQWKH(QJLQHHU¶VVLWHYLVLWUHSRUW,IWKH(QJLQHHULVQRW DYDLODEOH WKH &RQWUDFWRU LV UHVSRQVLEOH IRU SKRWRJUDSKLQJ WKHGDPDJHGGHWHULRUDWHG PDWHULDOVFRQGLWLRQVDQGSKRWRJUDSKLQJWKHUHSDLUHGUHSODFHGPDWHULDOVZLWKVFDOHWRDOORZIRU FRQILUPDWLRQRIPHDVXUHPHQWVRIWKHPDWHULDODQGVXEPLWWLQJWKHVHWRWKH(QJLQHHUDWWKHQH[WVLWH YLVLWRUSURJUHVVPHHWLQJ,IDSSURYHGE\WKH(QJLQHHULWPD\EHDFFHSWDEOHWRVWRFNSLOHUHPRYHG GHWHULRUDWLRQFRPSRQHQWPDWHULDOZKHQDSSOLFDEOHXQWLOFRQILUPDWLRQE\WKH(QJLQHHUFDQEH PDGH3D\PHQWIRUZRUNSHUIRUPHGRUFRQVLGHUDWLRQRIZRUNSHUIRUPHGWRZDUGWKHHVWLPDWHG TXDQWLWLHVPD\QRWEHSURYLGHGZLWKRXWSURSHUGRFXPHQWDWLRQ 25DLVHDOOSHQHWUDWLRQVDVQHHGHGWRILQLVKDPLQLPXPRIDERYHWKHILQLVKHGURRIVXUIDFH 3'RQRWEXUQRUEXU\PDWHULDOVRQVLWH 0(7$/'(&.5(3$,55(3/$&(0(17 $ 0HWDO'HFN5HSDLU'HWHULRUDWHGRUGDPDJHGDUHDVJUHDWHUWKDQDQGOHVVWKDQVTXDUHRU GLDPHWHURUOHVVVKDOOEHUHSDLUHGZLWKHLWKHUJDXJHVWHHOVKHHWRUWZROD\HUVRIJDXJHPHWDO 6KHHWVKDOOEHVL]HGWRH[WHQGDPLQLPXPRIRQDOOVLGHVEH\RQGWKHVL]HRIWKHGHILFLHQWDUHD 6HFXUHVKHHWWRWRSRIH[LVWLQJGHFNIODQJHZLWKIDVWHQHUVPLQLPXPSHUVLGHHTXDOO\VSDFHG % 0HWDO'HFN5HSODFHPHQW'HWHULRUDWHGRUGDPDJHGDUHDVJUHDWHUWKDQEXWOHVVWKDQVTXDUH RUGLDPHWHUVKDOOEHUHSDLUHGZLWKGHFNLQJ'HFNLQJVKDOOEHVL]HGWRH[WHQGDPLQLPXPRIRQ DOOVLGHVEH\RQGWKHVL]HRIWKHGHILFLHQWDUHD1HVWQHZGHFNDQGVHFXUHWRH[LVWLQJGHFNZLWK IDVWHQHUVPLQLPXPSHUVLGHHTXDOO\VSDFHGDQGRQHLQHDFKIOXWH & 0HWDO'HFN5HSODFHPHQW/DUJHU$UHDV'HWHULRUDWHGRUGDPDJHGDUHDVJUHDWHUWKDQVTXDUH RUGLDPHWHUVKDOOEHUHSDLUHGZLWKPHWDOGHFN5HSODFHPHQWGHFNVKDOOH[WHQGDPLQLPXPRIWKUHH VSDQV3HUPDQHQWO\DQFKRUXQLWVWRMRLVWDQGIDVWHQVLGHODSVE\WKHHQGRIHDFKZRUNLQJGD\$W DPLQLPXPIDVWHQHYHU\RWKHUULEDWDOOVXSSRUWVLQWKHILHOGDQGRFDORQJODSV$WDPLQLPXP IDVWHQHYHU\ULEDWDOOVXSSRUWVDQGRFDORQJODSVDWSHULPHWHUVDQGFRUQHUV ' ,PPHGLDWHO\DIWHUSODFHPHQWDQGDOLJQPHQWDQGDIWHUFRUUHFWLQJLQDFFXUDFLHVSHUPDQHQWO\IDVWHQ VWHHOGHFNXQLWVWRVWUXFWXUDOVXSSRUWVDQGWRDGMDFHQWGHFNXQLWVZLWKVFUHZVDWRQFHQWHU $WWDFKPHQWRIDGMDFHQWGHFNXQLWVE\EXWWRQSXQFKLQJLVSURKLELWHG 0(7$/'(&.5(6725$7,21 $:LUHEUXVKDQGVZHHSDOOORRVHUXVWIURPDIIHFWHGDUHD$UHDVRIGHFNHYLGHQFLQJSLQKROHVVKDOO EHUHSODFHGLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKLV6HFWLRQ %,QVWDOORQHFRDWRIUXVWLQKLELWRUWRDIIHFWHGDUHD &$OORZDUHDWRGU\EHIRUHSURFHHGLQJZLWKURRIV\VWHPLQVWDOODWLRQ (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±528*+&$53(175< 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 528*+&$53(175< 3$57 *(1(5$/ :25.,1&/8'(' $ 3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\WRFRPSOHWHWKHIROORZLQJZRUN 5HSODFHH[LVWLQJSHULPHWHUZRRGEORFNLQJWKDWLVLQWHQGHGIRUUHXVHZLWKLQWKHQHZURRI V\VWHPEXWLVGLVFRYHUHGWREHPLVVLQJGHWHULRUDWHGRUGDPDJHG(VWLPDWHGTXDQWLWLHVIRU PDWHULDOUHSODFHPHQWDUHLQFOXGHGLQ6HFWLRQ 5HSODFH H[LVWLQJ SO\ZRRG WKDW LV LQWHQGHG IRU UHXVH ZLWKLQ WKH QHZ URRI V\VWHP EXW LV GLVFRYHUHG WR EH PLVVLQJ GHWHULRUDWHG RU GDPDJHG (VWLPDWHGTXDQWLWLHV IRU PDWHULDO UHSODFHPHQWDUHLQFOXGHGLQ6HFWLRQ ,QVWDOOQHZZRRGEORFNLQJZKHUHVKRZQRQWKHGUDZLQJVDQGLQVWDOOSO\ZRRGRQWKH SDUDSHWZDOODWWKHORFDWLRQVVKRZQRQWKHGHWDLOGUDZLQJV 48$/,7<$6685$1&( $ &RQWUDFWRUVKDOOSURYLGHVXIILFLHQWTXDOLILHGZRUNPHQDQGVXSHUYLVRUVZKRVKDOOEHSUHVHQWDWDOOWLPHV GXULQJH[HFXWLRQRIWKLVSRUWLRQRIWKHZRUNDQGZKRVKDOOEHIDPLOLDUZLWKWKHW\SHRIFRQVWUXFWLRQ LQYROYHGDQGWKHPDWHULDOVDQGWHFKQLTXHVVSHFLILHG % 7KH2ZQHUVKDOOPDNHQRDOORZDQFHIRUODFNRIVNLOORIWKHZRUNPHQ 68%0,77$/6 $ 6XEPLWSURGXFWGDWDDQG6'6IRUHDFKSURGXFWOLVWHGLQWKLVVSHFLILFDWLRQVHFWLRQDQGRWKHUV UHTXLUHGE\WKHURRIPHPEUDQHPDQXIDFWXUHUIRUDFRPSOHWHLQVWDOODWLRQRIWKHZRUN % 6XEPLWSURGXFWGDWDIRUHDFKIDVWHQHUW\SHWREHXVHGLQWKHVHFXUHPHQWRIWKHEORFNLQJWRFRQFUHWH URRIGHFNVWHHORUPDVRQU\RURWKHUEORFNLQJDORQJZLWKDSK\VLFDOVDPSOHRIHDFKIDVWHQHUW\SH LIUHTXHVWHG&OHDUO\PDUNSURGXFWGDWDVKHHWVWRFRQILUPIDVWHQHUW\SHOHQJWKDQGORFDWLRQRI LQWHQGHGXVH7KH&RQWUDFWRUPD\UHVXEPLWDGGLWLRQDOIDVWHQHUW\SHVDQGGDWDLIDQ\FKDQJHWRWKH IDVWHQHUVWREHXVHGRFFXUV '(/,9(5<6725$*($1'+$1'/,1* $ 'HOLYHU URRILQJ PDWHULDOV LQVXODWLRQ DQG DFFHVVRULHV LQ PDQXIDFWXUHU¶V RULJLQDO SURWHFWLYH FRQWDLQHUVZLWKODEHOVLQWDFWDQGOHJLEOH&RPSO\ZLWKPDQXIDFWXUHU¶VSXEOLVKHGLQVWUXFWLRQVIRU VWRUDJHDQGKDQGOLQJ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±528*+&$53(175< 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW % 6WRUHPDWHULDOVLQGU\SURWHFWHGDUHDVRQFOHDQUDLVHGSODWIRUPVZLWKVHFXUHO\DQFKRUHGZHDWKHU SURWHFWLYHFRYHULQJVLQDFFRUGDQFHZLWK6HFWLRQ & 6WRUHIODPPDEOHSURGXFWVDZD\IURPVSDUNVRURSHQIODPHV ' 0DLQWDLQWHPSHUDWXUHDQGKXPLGLW\UDQJHVUHTXLUHGE\WKHPDQXIDFWXUHUIRUHDFKSURGXFW 3$57 352'8&76 0$7(5,$/6 $ :RRG%ORFNLQJ7UHDWHG6KDOOEH1RRUEHWWHUVRXWKHUQ\HOORZSLQHNLOQGULHGSULRUWRDQGDIWHU WUHDWPHQW.'$7WRDPRLVWXUHFRQWHQWRIQRWPRUHWKDQSHUFHQW6KDOOEHVRXQGWKRURXJKO\ VHDVRQHGGUHVVHGWRQRPLQDOILQLVKGLPHQVLRQDQGIUHHRIZDUSDJHFXSSLQJDQGERZLQJ$OOQDLOHUV DQGRWKHUEORFNLQJDVVRFLDWHGZLWKWKHURRILQJLQVWDOODWLRQVKDOOEHSUHVVXUHWUHDWHGZLWKSFI UHWHQWLRQRIDONDOLQHFRSSHUTXDWHUQDU\$&4DQGVKDOOFRQIRUPWR$:3$6WDQGDUG8WRWKH UHTXLUHPHQWVRIXVHFDWHJRU\IRUJURXQGFRQWDFW$VSKDOWLFRUFUHRVRWHSUHVHUYDWLYHVVKDOOQRWEHXVHG 7KHSUHVHQFHRI$:3$PDUNFRQILUPLQJSUHVHUYDWLYHW\SHDQGUHWHQWLRQXVHFDWHJRU\RQHDFKSLHFH LVUHTXLUHG:KHUHIXOOSHQHWUDWLRQRI$&4LVQRWHYLGHQWILHOGFXWVVKDOOEHFRDWHGLQDFFRUGDQFHZLWK $:3$VWDQGDUG8'LPHQVLRQVVKDOOEHGHWHUPLQHGE\MREFRQGLWLRQV6LWHVDZQHQGVVKDOOEH WUHDWHGZLWKRQHFRDWRISUHVHUYDWLYHWUHDWPHQW % 3O\ZRRG6KDOOEHVWDPSHG$3$UDWHG&';&VLGHRXWVPRRWKIDFHGH[WHULRUJUDGH([SRVXUH PLQLPXP )RU SO\ZRRG LQVWDOOHG WR UHSDLUUHSODFHPHQW H[LVWLQJ PDWHULDOV PDWFK WKH H[LVWLQJ SO\ZRRGWKLFNQHVVILHOGYHULI\H[DFWO\WRPDLQWDLQDIOXVKVXUIDFHZLWKVXUURXQGLQJPDWHULDOV)RU QHZSO\ZRRGSURYLGHDPLQLPXPWKLFNQHVV&RQWUDFWRUPD\XVHWZROD\HUVRIIRUUDGLXV ZDOOV $&&(6625,(6 $)DVWHQHUVVSHFLILHGVKDOOEHWKHPLQLPXPUHTXLUHGSURGXFW,IDFRQGLWLRQH[LVWVWKDWGRHVQRWPDWFKD IDVWHQHUFRQGLWLRQRUW\SHOLVWHGEHORZWKH&RQWUDFWRUPD\VXEPLWDVHSDUDWHW\SHDQGSURILOHRI IDVWHQHUIRUUHYLHZ$OOIDVWHQHUVWREHXVHGWRVHFXUHWUHDWHGZRRGSURGXFWVPXVWEHDVWDLQOHVVVWHHO %:RRGWRPDVRQU\FRQFUHWH0LQLPXPƎGLDPHWHUVWDLQOHVVVWHHOPDVRQU\FRQFUHWHDQFKRUV :KHUHDGGLWLRQDOZRRGEORFNLQJURRIPHPEUDQHRUVKHHWPHWDOIODVKLQJZLOOFRYHUWKHVHFXUHG ZRRGFRPSRQHQWDQFKRUKHDGVPXVWEHHLWKHUFRXQWHUVXQNRURWKHUZLVHILQLVKIOXVKZLWKWKH VXUIDFHRIWKHZRRG0LQLPXPHPEHGPHQWLQWRWKHVXEVWUDWHVKDOOEHƎXQOHVVRWKHUZLVHUHTXLUHG E\ WKH PDQXIDFWXUHU WR PHHW UHTXLUHG SXOORXW UHVLVWDQFH 3UHGULOO IRU IDVWHQHUV DV UHTXLUHGUHFRPPHQGHGE\WKHPDQXIDFWXUHURUQHFHVVDU\WRSUHYHQWVSDOOLQJRIWKHVXEVWUDWH PDWHULDO3ODVWLFRUQ\ORQDQFKRUVVKDOOQRWEHDOORZHG)DVWHQHUVSDFLQJVKDOOQRWH[FHHGƎRQ FHQWHUXQOHVVRWKHUZLVHQRWHGRQWKHGUDZLQJV &:RRGWRVWHHODQJOHV0LQLPXPVHOIWDSSLQJVWDLQOHVVVWHHOƎQRVFUHZVDQGDPLQLPXP RIƎORQJ8VHDIODWKHDGVFUHZ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±528*+&$53(175< 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ':RRGWRPHWDOJHQHUDO0LQLPXPVHOIWDSSLQJVWDLQOHVVVWHHOQRVFUHZV:KHUHDGGLWLRQDO ZRRGEORFNLQJURRIPHPEUDQHRUVKHHWPHWDOIODVKLQJZLOOFRYHUWKHZRRGFRPSRQHQWDQFKRU KHDGVPXVWEHHLWKHUFRXQWHUVXQNRURWKHUZLVHILQLVKIOXVKZLWKWKHVXUIDFHRIWKHZRRG0LQLPXP IDVWHQHUSHQHWUDWLRQVKDOOEHƎXQOHVVRWKHUZLVHUHTXLUHGE\WKHPDQXIDFWXUHUWRPHHWUHTXLUHG SXOORXWUHVLVWDQFH ( :RRGWRZRRG0LQLPXP1RVWDLQOHVVVWHHOZRRGVFUHZV:KHUHDGGLWLRQDOZRRGEORFNLQJURRI PHPEUDQHRUVKHHWPHWDOIODVKLQJZLOOFRYHUWKHZRRGFRPSRQHQWIDVWHQHUKHDGVPXVWEHHLWKHU FRXQWHUVXQNRURWKHUZLVHILQLVKIOXVKZLWKWKHVXUIDFHRIWKHZRRG0LQLPXPIDVWHQHUSHQHWUDWLRQLQWR WKHZRRGEORFNLQJVXEVWUDWHEHORZVKDOOEHƎ ) )DVWHQHUVSDFLQJLVJHQHUDOO\LQGLFDWHGRQWKHGHVLJQGHWDLOVEXWLIIDVWHQHUVDUHQRWVSHFLILFDOO\VKRZQ RUVSDFLQJQRWQRWHGSURYLGHDPD[LPXPƎRQFHQWHUVWDJJHUHGIRUZRRGEORFNLQJZLWKIDVWHQHUV DWHDFKHQGRUIDVWHQHUIRUHDFKVTXDUHIHHWIRUSO\ZRRGXQOHVVRWKHUZLVHUHTXLUHGE\WKHURRI V\VWHPPDQXIDFWXUHU 3$57 (;(&87,21 ,163(&7,21 $ 9HULI\ WKDW H[LVWLQJ FRQVWUXFWLRQ LV VRXQG DQG GU\ VR DV WRDGHTXDWHO\ VXSSRUW QHZ URRILQJ FRPSRQHQWV % 9HULI\WKDWFXUEVDUHVRXQGILUPO\DQFKRUHGVPRRWKDQGFOHDQRQVXUIDFHVVFKHGXOHGWRUHFHLYH QHZQDLOHUV & 9HULI\WKDWVXUIDFHVRIPDVRQU\ZDOOVDUHOHYHOVRXQGILUPO\DQFKRUHGDQGVPRRWK ' 7KH2ZQHU¶VUHSUHVHQWDWLYHDQGWKH&RQWUDFWRUVKDOOGRFXPHQWWKHDFWXDOTXDQWLWLHVRIPDWHULDOV LQVWDOOHGZKHQH[LVWLQJGHWHULRUDWHGPDWHULDOVPXVWEHUHSODFHG ,167$//$7,21±1$,/(56$1'%/2&.,1* $9HULI\WKDWH[LVWLQJFRQVWUXFWLRQLVVRXQGDQGGU\VRDVWRDGHTXDWHO\VXSSRUWQHZFRPSRQHQWV %,QVWDOOZRRGSHULPHWHUEORFNLQJZKHUHVKRZQRQWKHGUDZLQJVRULQGLFDWHGLQWKHVSHFLILFDWLRQV&XW EORFNLQJWRVL]HZKHUHVKRZQRQWKHGUDZLQJVRUUHTXLUHGIRUSURSHULQVWDOODWLRQRIWKHZRUN &,QVWDOOQHZZRRGEORFNLQJDWRWKHUORFDWLRQVDVVKRZQRQWKHGUDZLQJVRUUHTXLUHGE\WKHURRIV\VWHP PDQXIDFWXUHUIRUSURSHULQVWDOODWLRQRIWKHGHWDLOV ')DVWHQH[LVWLQJZRRGQDLOHUVEORFNLQJHWFDWVSDFLQJVWRFRPSO\ZLWKQHZPHPEUDQHPDQXIDFWXUHU¶V ODWHVW ZULWWHQ LQVWUXFWLRQV RU WKH IDVWHQLQJ UHTXLUHPHQWV SURYLGHG LQ WKLV VSHFLILFDWLRQ VHFWLRQ ZKLFKHYHULVPRUHVWULQJHQW:RRGEORFNLQJDQGQDLOHUVVKDOOEHVHFXUHO\DQFKRUHGWRWKHURRIGHFN WRUHVLVWDPLQLPXPXSOLIWIRUFHRISRXQGVSHUOLQHDUIRRWEXWQRPRUHWKDQRFDSDUW,I IDVWHQHUSXOORXWYDOXHVSHUIRUPHGE\WKH&RQWUDFWRUSULRUWRVWDUWRIZRUNLQGLFDWHWKDWVSHFLILHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±528*+&$53(175< 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW IDVWHQLQJSDWWHUQVZLOOQRWPHHWWKLVUHTXLUHPHQWLQFUHDVHWKHQXPEHURIIDVWHQHUVDVQHFHVVDU\WRPHHW UHTXLUHPHQW ($QFKRUQHZDQGH[LVWLQJSHULPHWHUQDLOHUVLQDFFRUGDQFHZLWK)0/RVV3UHYHQWLRQ'DWD6KHHW $QFKRUVVKDOOEHFRXQWHUVXQNWRSURYLGHDIOXVKILQLVK )6HFXUHQHZSO\ZRRGWRYHUWLFDOVXUIDFHVDW´RFDORQJWKHWRSDQGERWWRPRIWKHVKHHWVDQGDWD VSDFLQJRI´RFWKURXJKRXWWKHERDUGXQOHVVRWKHUZLVHQRWHGRQWKHGUDZLQJV *)DVWHQHUVVKDOOEHSRVLWLRQHGIURPHDFKHQGDQGDPD[LPXPRIƎRQFHQWHUDQGVWDJJHUHGWKH QDLOHUZLGWK7ZRIDVWHQHUVVKDOOEHLQVWDOOHGDWHQGVRIQDLOHUOHQJWKV:RRGQDLOHUSLHFHVVKDOOEHQR OHVVWKDQƎLQOHQJWKDQGVKDOOEHVHFXUHGZLWKDPLQLPXPRIWZRIDVWHQHUVSHUSLHFH +$OOQDLOHUVDWSHULPHWHUVFXUEVRUVFXSSHUVHWFVKDOOILQLVKIOXVKZLWKWKHLQVXODWLRQXQOHVVRWKHUZLVH QRWHGRQWKHGUDZLQJV ,,QVWDOOQHZZRRGPDWHULDOVWUXHWROLQHOHYHOSOXPEDQGVHFXUHO\IDVWHQHGWRWKHDSSURYHGVXEVWUDWH ZLWKIDVWHQHUW\SHDQGIDVWHQLQJUHTXLUHPHQWVDVVSHFLILHG -1HZZRRGQDLOHUVVKDOOKDYHDJDSEHWZHHQHDFKOHQJWK .:KHUHQHZRUUDLVHGZRRGFXUEVDUHWREHLQVWDOOHGFRUQHUVVKDOOEHIRUPHGE\ODSSLQJVLGHPHPEHUV DOWHUQDWHO\ (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 7+(5023/$67,&0(0%5$1(522),1* 3$57 *(1(5$/ :25.,1&/8'(' $3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\WRLQVWDOODQHZWKHUPRSODVWLFVLQJOH SO\URRIPHPEUDQHV\VWHPIODVKLQJVDQGDFFHVVRULHVIROORZLQJDQGDFFHVVRULHVIROORZLQJUHPRYDO DQGGLVSRVDORIWKHH[LVWLQJURRIPDWHULDOV %,QVWDOOQHZIXOO\DGKHUHGKHDWZHOGHGWKHUPRSODVWLFURRIV\VWHPZLWKIODWWDSHUHGLQVXODWLRQ FRYHUERDUGPHPEUDQHEDVHIODVKLQJVPHPEUDQHFODGPHWDODQGRWKHUDVVRFLDWHGFRPSRQHQWVDV UHTXLUHGIRUSURSHULQVWDOODWLRQRIWKHRYHUDOOV\VWHPLQDFFRUGDQFHZLWKWKHVHVSHFLILFDWLRQVDQG WKHURRIV\VWHPPDQXIDFWXUHU¶VLQVWDOODWLRQLQVWUXFWLRQV &3URYLGH DQG LQVWDOO FRSLQJ VKHHWPHWDO IODVKLQJV FRXQWHUIODVKLQJV RWKHU VKHHWPHWDO WULP DQG DFFHVVRULHVLQDFFRUGDQFHZLWK6HFWLRQ '3URYLGHDQGLQVWDOORWKHUDFFHVVRU\RULQFLGHQWDOFRPSRQHQWVRUPRGLI\RWKHUURRIIHDWXUHVLWHPV QRWVSHFLILFDOO\OLVWHGRUVKRZQRQGUDZLQJVEXWUHTXLUHGIRUWKHFRPSOHWHDQGSURSHULQVWDOODWLRQ RIWKHQHZURRIV\VWHP (7KH QHZ URRI V\VWHP VKDOO EH ZDWHUWLJKW PXVW PHHW WKH UHTXLUHPHQWV IRU 8/ &ODVV $ ILUH FODVVLILFDWLRQVDQGVKDOOPHHWWKHUHTXLUHPHQWVIRUZLQGXSOLIWDVVSHFLILHGKHUHLQDQGLQDFFRUGDQFH ZLWKWKH1RUWK&DUROLQD6WDWH%XLOGLQJ&RGHDQG$6&(7KHRYHUDOOTXDOLW\RIURRIV\VWHP LQVWDOODWLRQVKDOOEHVXIILFLHQWWRREWDLQWKHPDQXIDFWXUHU¶VVSHFLILHGZDUUDQW\PHHWUHFRJQL]HG LQGXVWU\VWDQGDUGVDQGVKDOOQRWLQFOXGHGLVWUHVVHVRUGDPDJHVWKDWPD\SUHYHQWWKHPHPEUDQHDQG IODVKLQJVWRFRQWLQXHWRSHUIRUPLQDZDWHUWLJKWFRQGLWLRQZLWKUHDVRQDEOHPDLQWHQDQFHRYHUWKH \HDUPDQXIDFWXUHU¶VZDUUDQW\SHULRG )%LG$OWHUQDWH5HSODFHH[LVWLQJSLSHLQVXODWLRQZKHUHQRWHGRQWKHGUDZLQJV 48$/,7<$6685$1&( $ 2EWDLQURRIPHPEUDQHLQVXODWLRQIODVKLQJVDQGDFFHVVRULHVIURPDVLQJOHPDQXIDFWXUHUZLWKQRWOHVV WKDQ\HDUVRIVXFFHVVIXOH[SHULHQFHLQPDQXIDFWXUHRIDWKHUPRSODVWLFPHPEUDQHPHHWLQJWKH VSHFLILHGUHTXLUHPHQWVDQGZLWKRXWVLJQLILFDQWFKDQJHWRWKHFKHPLFDOIRUPXODWLRQ3URYLGHRWKHU V\VWHPFRPSRQHQWVVXFKDVDGKHVLYHVIDVWHQHUVWHUPLQDWLRQEDUVSLSHERRWVDQGPHPEUDQHFRDWHG PHWDOIODVKLQJVRQO\DVDSSURYHGE\PDQXIDFWXUHURISULPDU\PHPEUDQHPDWHULDOVIRUWKHZDUUDQWHG V\VWHP % &RQWUDFWRUVKDOOEHDQDSSURYHGDXWKRUL]HGDSSOLFDWRURIWKHPDQXIDFWXUHUIRULQVWDOODWLRQRIWKH SURGXFWWREHLQVWDOOHG$SSURYHGVWDWXVPXVWEHLQSODFHSULRUWRWKHELGGDWH&HUWLILFDWLRQRIWKH FRQWUDFWRU¶VVWDWXVRUWKHVWDWXVRIDGHVLJQDWHGVXEFRQWUDFWRUZLWKWKHPDQXIDFWXUHUPD\EHUHTXHVWHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW IRUWKHSXUSRVHRIUHYLHZLQJDQGHYDOXDWLQJELGVDQGIDLOXUHWRSURYLGHUHTXHVWHGGRFXPHQWDWLRQPD\ UHVXOWLQGLVTXDOLILFDWLRQRIELG & 8VHDGHTXDWHQXPEHURIVNLOOHGZRUNPHQZKRDUHWUDLQHGDQGH[SHULHQFHGLQWKHQHFHVVDU\FUDIWVDQG ZKRDUHIDPLOLDUZLWKWKHVSHFLILHGUHTXLUHPHQWVDQGWKHPHWKRGVQHHGHGIRUSHUIRUPDQFHRIWKH :RUN&RQWUDFWRUVKDOOKDYHDPLQLPXPRIWZR\HDU¶VH[SHULHQFHZLWKWKHLQVWDOODWLRQRIVLQJOH SO\WKHUPRSODVWLFPHPEUDQHVZLWKKHDWZHOGHGVHDPV ' &RPSO\ZLWKSHUWLQHQWFRGHVDQGUHJXODWLRQVLQFOXGLQJUHFRPPHQGDWLRQVFRQWDLQHGLQWKHPRVWUHFHQW HGLWLRQRIWKH0DQXDORI/RZ6ORSHG5RRILQJDQGVLQJOHSO\WKHUPRSODVWLFGHWDLOVSXEOLVKHGE\WKH 15&$ DQG WKH PDQXIDFWXUHU¶V ZULWWHQ LQVWDOODWLRQ LQVWUXFWLRQV :KHUH PDQXIDFWXUHU RU 15&$ UHFRPPHQGDWLRQVGLIIHUIURPWKHGHVLJQVSHFLILFDWLRQVDQGGUDZLQJVWKHPRUHVWULQJHQWUHTXLUHPHQW ZLOOWDNHSUHFHGHQFHXQOHVVRWKHUZLVHDJUHHGXSRQZLWKWKH(QJLQHHU ( 8QOHVV RWKHUZLVH DJUHHG XSRQ ZLWK WKH 'HVLJQHU DQG 2ZQHU SURYLGH DQ RQVLWH UHIUHVKHU FRXUVHWUDLQLQJVHVVLRQE\WKHPDQXIDFWXUHU¶VWHFKQLFDOSHUVRQQHOWRHQVXUHWKHFUHZLVFDSDEOHRI SURSHUKHDWZHOGLQJRIWKHPDQXIDFWXUHU¶VPHPEUDQH7KH&RQWUDFWRUPD\KROGWKLVWUDLQLQJDW WKHLURIILFHLQOLHXRIRQVLWHRQO\LIDSSURYHGZLWKWKH'HVLJQHULQDGYDQFH7KLVUHTXLUHPHQWPD\ EHZDLYHGLIWKH&RQWUDFWRUFDQSURYLGHFRQILUPDWLRQIURPWKHPDQXIDFWXUHUWKDWWKHVSHFLILF ZRUNHUV WKDW ZLOO SHUIRUP LQVWDOODWLRQ KDYH XQGHUJRQH PDQXIDFWXUHUSURYLGHG KHDWZHOGLQJ WUDLQLQJRQWKHLUPHPEUDQHZLWKLQPRQWKVRIWKHVWDUWGDWHRIWKHSURMHFW ) 3URYLGHDPLQLPXPRIWKUHHRQWKHMRELQVSHFWLRQVDQGRQHILQDOLQVSHFWLRQE\WKHPDQXIDFWXUHU GXULQJPHPEUDQHLQVWDOODWLRQWHFKQLFDODVVLVWDQFHDQGPDWHULDODSSOLFDWLRQJXLGDQFHDVQHFHVVDU\ WRFRPSOHWHWKHURRIPHPEUDQHV\VWHPLQVWDOODWLRQLQDFFRUGDQFHZLWKWKHPHPEUDQHV\VWHP PDQXIDFWXUHU¶VZDUUDQW\UHTXLUHPHQWVDQGWKHVHVSHFLILFDWLRQV * $HVWKHWLF &RQVLGHUDWLRQV $Q DHVWKHWLFDOO\ SOHDVLQJ RYHUDOO DSSHDUDQFH RI WKH ILQLVKHG URRI DSSOLFDWLRQ LV GHVLUHG IRU WKLV SURMHFW 0DNH QHFHVVDU\ SUHSDUDWLRQV XWLOL]H UHFRPPHQGHG DSSOLFDWLRQWHFKQLTXHVDSSO\WKHVSHFLILHGPDWHULDOVDQGH[HUFLVHFDUHLQHQVXULQJWKDWWKHILQLVKHG DSSOLFDWLRQLVDFFHSWDEOHWRWKH(QJLQHHUDQG2ZQHU 68%0,77$/6 $ 6XEPLWZULWWHQFRQILUPDWLRQRIFRQWUDFWRU¶VDSSURYHGDSSOLFDWRU¶VVWDWXVIURPWKHURRIPHPEUDQH V\VWHPPDQXIDFWXUHULIQRWSURYLGHGDVDSDUWRIWKHELGHYDOXDWLRQDQGDSSURYDOSURFHVV % 6XEPLW D Ǝ E\ Ǝ VDPSOH RI URRILQJ PHPEUDQH LQVXODWLRQ ERDUG FRYHUERDUG DQG RWKHU DFFHVVRULHVZLWKPDQXIDFWXUHU¶VLGHQWLILFDWLRQODEHOVDWWDFKHGRQO\LIVSHFLILFDOO\UHTXHVWHGE\WKH (QJLQHHU & 6XEPLW SURGXFW GDWD DQG 6'6 IRU HDFK SURGXFW OLVWHG LQ WKLVVSHFLILFDWLRQ VHFWLRQ IRU URRI DFFHVVRULHVDQGIRURWKHUSURGXFWVUHTXLUHGE\WKHURRIPHPEUDQHPDQXIDFWXUHUIRUDFRPSOHWH LQVWDOODWLRQRIWKHZRUN ' 6XEPLWPHPEUDQHPDQXIDFWXUHU¶VDSSOLFDWLRQPDQXDOVZKLFKGHVFULEHFRPSOHWHO\WKHSUHSDUDWLRQ RIVXUIDFHVDQGDSSOLFDWLRQRIVSHFLILHGPDWHULDOV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ( 6XEPLWDWDSHUHGLQVXODWLRQOD\RXW/D\RXWSODQPXVWVKRZGUDLQVXPSVFULFNHWVDWXSVORSHVLGHRI FXUEHGXQLWVDQGLVRODWHGVXSSOHPHQWDOWDSHUDQGVKDOOEHFRQILUPHGRQWKHOD\RXWE\WKHFRQWUDFWRU SULRUWRVXEPLWWDOWRVKRZDFWXDOLQWHQGHGLQVWDOODWLRQDQGQRWEHVROHO\IRUWKHSXUSRVHRIPDWHULDO WDNHRIIRURUGHULQJ ) 6XEPLW VKRS GUDZLQJV VKRZLQJ GHWDLO IDEULFDWLRQ DQG IDVWHQLQJ GHYLFHV IRU HDFK FRQGLWLRQ HQFRXQWHUHG7KLVLQFOXGHVEXWLVQRWOLPLWHGWRSHULPHWHUDQGFRUQHU]RQHGLPHQVLRQVLQVXODWLRQ IDVWHQLQJSDWWHUQVDGKHVLYHSDWWHUQVJHQHUDOVKHHWOD\RXWPHWDOIDEULFDWLRQVKDSHVIDVWHQHUW\SHV DQGVSDFLQJDQGRWKHUVSHFLILFFRPSRQHQWVHWF'XHWRVLWHVSHFLILFFRQGLWLRQVVRPHGHVLJQGHWDLOV PD\KDYHQRQVWDQGDUGFRQGLWLRQVDQGVWDQGDUGPDQXIDFWXUHU¶VGHWDLOPD\QRWEHDSSOLFDEOH:KHUH QRQVWDQGDUGFRQGLWLRQVDUHSUHVHQWSURYLGHVSHFLILFFRQILUPDWLRQRIDFFHSWDELOLW\E\WKHZDUUDQWLQJ PDQXIDFWXUHU * 6XEPLW D VDPSOH FRS\ RI WKH PHPEUDQH PDQXIDFWXUHU¶V ZDUUDQW\ DQG FRQWUDFWRU¶V ZDUUDQW\ $OWKRXJKWKHZDUUDQW\PD\EHDVDPSOHFRS\LWVKRXOGEHDUWKHSURMHFWQDPHDQGKDYHDQ\ZDUUDQW\ OHQJWKVDQGDSSOLFDEOHULGHUVPDUNHGLQWRFRQILUPLWPHHWVWKHVSHFLILHGUHTXLUHPHQWV '(/,9(5<6725$*($1'+$1'/,1* $ 'HOLYHU URRILQJ PDWHULDOV LQVXODWLRQ DQG DFFHVVRULHV LQ PDQXIDFWXUHU¶V RULJLQDO SURWHFWLYH FRQWDLQHUVZLWKODEHOVLQWDFWDQGOHJLEOH&RPSO\ZLWKPDQXIDFWXUHU¶VSXEOLVKHGLQVWUXFWLRQVIRU VWRUDJHDQGKDQGOLQJ % 6WRUHPDWHULDOVLQGU\SURWHFWHGDUHDVRQFOHDQUDLVHGSODWIRUPVZLWKVHFXUHO\DQFKRUHGZHDWKHU SURWHFWLYHFRYHULQJVLQDFFRUGDQFHZLWK6HFWLRQ & 6WRUH IODPPDEOH SURGXFWV DZD\ IURP VSDUNV RU RSHQ IODPHV *DVROLQH DQG RSHQ IODPPDEOH PDWHULDOVVKDOOEHUHPRYHGIURPWKHURRIGDLO\ ' 6WRUHURRILQJPDWHULDOVZLWKLQWHPSHUDWXUHDQGKXPLGLW\UDQJHVUHFRPPHQGHGE\WKHSULRUWRXVH DVUHFRPPHQGHGE\WKHURRIPHPEUDQHV\VWHPPDQXIDFWXUHU3URWHFWPDWHULDOIURPIUHH]LQJ (19,5210(17$/5(48,5(0(176 $ 3URFHHGZLWKURRILQJZRUNRQO\ZKHQZHDWKHUFRQGLWLRQVFRPSO\ZLWKURRIPHPEUDQHV\VWHP PDQXIDFWXUHU¶VUHFRPPHQGDWLRQV'RQRWYLRODWHWHPSHUDWXUHOLPLWDWLRQVUHFRPPHQGHGE\WKH PDQXIDFWXUHU :$55$17,(6 $ 3URYLGHD&RQWUDFWRU¶V)LYH<HDU:DUUDQW\IRUZRUNLQFOXGHGLQWKLVSURMHFWLQDFFRUGDQFHZLWK 6HFWLRQRIWKHVHVSHFLILFDWLRQV % 3URYLGHURRIPHPEUDQHV\VWHPPDQXIDFWXUHU¶VWZHQW\\HDUQRQSURUDWHGIXOOV\VWHPZDUUDQW\ FRYHULQJODERUPDWHULDOVDQGZRUNPDQVKLSRIWKHURRILQJV\VWHPDJDLQVWOHDNDJHDQGPDWHULDO DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW GHIHFWV 7KH ZDUUDQW\ ZLOO H[WHQG IRU D SHULRG RI WZHQW\ \HDUV IURP WKH GDWH RI )LQDO &RPSOHWLRQ ,I WKH ZDUUDQW\ LQFOXGHV H[FOXVLRQDU\ ODQJXDJH IRU ZLQG HYHQWVVXFK DV ³JDOH´ RU ³KXUULFDQH´ WKH ZDUUDQW\ VKDOO FODULI\ RU VKDOO KDYH DQ DWWDFKHG OHWWHU IURP WKH PDQXIDFWXUHUWRFODULI\WKHPD[LPXPZLQGVSHHGFRYHUHGE\WKHZDUUDQW\:DUUDQW\VKDOO FRYHUDWPLQLPXPZLQGVSHHGVXSWRPLOHVSHUKRXU 7KHPDQXIDFWXUHUVKDOOUHSODFHLQVXODWLRQDQGRWKHUURRIV\VWHPPDWHULDOVZKLFKKDYHEHHQ GDPDJHGE\OHDNDJHZKHQWKDWLQVXODWLRQRUPDWHULDOFRQWDLQVGHWULPHQWDODPRXQWVRI PRLVWXUH 7KHVWDQGDUGPDQXIDFWXUHU VZDUUDQW\VKDOOQRWEHYRLGHGE\SRQGLQJRUVWDQGLQJZDWHU 7KHPDQXIDFWXUHU¶VZDUUDQW\VKDOOQRWUHTXLUHWKHVLJQDWXUHRIWKH2ZQHU¶VUHSUHVHQWDWLYHWR EHYDOLG 7KH&RQWUDFWRUPXVWFRRUGLQDWHWKHQXPEHURIVLWHYLVLWVUHTXLUHGE\WKHPDQXIDFWXUHUWR LVVXHWKHZDUUDQW\ $PLQLPXPRIWKUHHYLVLWVDQGRQHILQDOLQVSHFWLRQWRWKHVLWHE\DWHFKQLFDOUHSUHVHQWDWLYH RIWKHURRIV\VWHPPDQXIDFWXUHUDUHUHTXLUHG7KHURRILQJFRQWUDFWRULVVROHO\UHVSRQVLEOH IRUVFKHGXOLQJVLWHYLVLWVE\WKHURRIV\VWHPPDQXIDFWXUHUDVQHFHVVDU\IRUWKHVSHFLILF SXUSRVHRILVVXLQJWKHVSHFLILHGZDUUDQW\$FRS\RIWKHPDQXIDFWXUHU¶VLQVSHFWLRQUHSRUWV DQGOLVWRILWHPVUHTXLULQJUHSDLUFRPSOHWLRQVKDOOEHSURYLGHGWRWKH(QJLQHHUIRUUHYLHZ & 0DQXIDFWXUHUDQG&RQWUDFWRUZDUUDQWLHVVKDOODOVRVWDWHWKDWWKH2ZQHUKDVWKHULJKWDWDQ\WLPH GXULQJWKHZDUUDQW\SHULRGWRPDNHHPHUJHQF\URRILQJUHSDLUVWRSURWHFWWKHFRQWHQWVRIWKH EXLOGLQJRUWKHEXLOGLQJLWVHOIIURPGDPDJHGXHWROHDNLQJ(PHUJHQF\UHSDLUVE\WKH2ZQHUVKDOO EHPDGHLQDFFRUGDQFHZLWKURRILQJLQGXVWU\VWDQGDUGVIRUWHPSRUDU\UHSDLUEXWZLOOQRWDEVROYH WKH2ZQHURIFRQWDFWLQJWKHZDUUDQWLQJ&RQWUDFWRURU0DQXIDFWXUHUDVUHTXLUHG,IHPHUJHQF\ UHSDLUVZLOOQRWEHDOORZHGWKHZDUUDQWLQJHQWLW\PXVWSURYLGHHPHUJHQF\UHVSRQVHZLWKLQWKH LQLWLDOKRXUVIRUWKH&RQWUDFWRU:DUUDQW\DQGZLWKLQKRXUVIRUWKH0DQXIDFWXUHUZDUUDQW\ IROORZLQJQRWLILFDWLRQ 3$57 352'8&76 522),168/$7,21$1'&29(5%2$5' $*HQHUDO3URYLGHSUHIRUPHGURRILQJLQVXODWLRQDQGFRYHUERDUGVWKDWFRPSO\ZLWKUHTXLUHPHQWV VHOHFWHG IURP PDQXIDFWXUHU¶V VWDQGDUG VL]HV DQG RI WKLFNQHVVHVLQGLFDWHG ,QVXODWLRQ DQG FRYHUERDUGPXVWEHVXSSOLHGE\RUDSSURYHGLQZULWLQJE\WKHZDUUDQWLQJPDQXIDFWXUHURIWKHURRI PHPEUDQHV\VWHP %%RDUG,QVXODWLRQ%DVH/D\HUDQG7DSHUHG&ORVHGFHOOSRO\LVRF\DQXUDWHULJLGLQVXODWLRQZLWK IRDP FRUH DQG IDFWRU\ ODPLQDWHG ILEHUJODVV IDFHUV DFFHSWDEOH IRU LQVWDOODWLRQ E\ PHFKDQLFDO IDVWHQLQJ)RDPFRUHVKDOOKDYHDIODPHVSUHDGRIRUOHVVSHU$670(DQGVKDOOKDYHD PLQLPXPGHQVLW\RISFI&RPSUHVVLYHVWUHQJWKVKDOOEHSVLPLQLPXPLQDFFRUGDQFHZLWK $670'%RDUGLQVXODWLRQVKDOOFRQIRUPWR$6707\SH,,&ODVV*UDGH%DVH OD\HULQVXODWLRQIRU5RRI$UHD$VKDOOEHWKLFN7KHVDGGOHVFULFNHWVVKDOOEHSHUIRRW WDSHUHGLQVXODWLRQ7KHEDVHDQGILOOLQVXODWLRQPD\EHƍ[ƍDQGWKHWDSHUHGLQVXODWLRQVKDOOEH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ƍ[ƍ & %RDUG,QVXODWLRQ7RS/D\HU6KDOOEHDFRPSRVLWHLQVXODWLRQFRPSRVHGRIDPLQLPXPSVL KLJKGHQVLW\SRO\LVRF\DQXUDWHODPLQDWHGWRDSVLFORVHGFHOOSRO\LVRF\DQXUDWHULJLGLQVXODWLRQ ZLWKIRDPFRUHDQGIDFWRU\ODPLQDWHGILEHUJODVVIDFHUVDFFHSWDEOHIRULQVWDOODWLRQXVLQJORZULVH SRO\XUHWKDQHIRDPDGKHVLYH%RDUGLQVXODWLRQVKDOOFRQIRUPWR$6707\SH,9 ' &RYHUERDUG,QVWDOORYHUVDGGOHVFULFNHWV6KDOOEHDWKLFNKLJKGHQVLW\SRO\LVRF\DQXUDWH7KH ERDUGVKDOOKDYHDFRPSUHVVLYHVWUHQJWKRISVLGLPHQVLRQDOVWDELOLW\RIOHVVWKDQDQGPHHW )0UHTXLUHPHQWV7KHERDUGVKDOODOVRPHHW)0)0DQG8/7KHVL]HRIWKH ERDUGVVKDOOEHƍ[ƍIRUDGKHUHGDSSOLFDWLRQV%RDUGVKDOOFRQIRUPWR$670&7\SH,, &ODVV*UDGH ( $GKHVLYHIRU,QVXODWLRQ$WWDFKPHQW3URYLGHORZULVHSRO\XUHWKDQHDGKHVLYHVSHFLILFDOO\GHVLJQHG IRUERQGLQJVSHFLILHGFRYHUERDUGWRURRILQVXODWLRQ$GKHVLYHVKDOOEHSUHDSSURYHGE\WKHURRI V\VWHPPDQXIDFWXUHUIRUXVHZLWKWKHSURSRVHGV\VWHPLQVXODWLRQDQGH[LVWLQJGHFNFRQGLWLRQV $GKHVLRQWHVWLQJZLOOEHUHTXLUHG ) )DVWHQHUVDQG3ODWHV6KDOOEHFRUURVLRQUHVLVWDQWKHDY\GXW\DOOSXUSRVHVFUHZRUQDLOLQ IDVWHQHUZLWKORZSURILOHKHDGDQGPLQLPXPƎGLDPHWHUJDOYDQL]HGVWHHORU$=JDOYDOXPHVWUHVV SODWH)DVWHQHUVVKDOOEHFDUERQVWHHOFRDWHGWRUHVLVWFRUURVLRQLQDFFRUGDQFHZLWK)0)DVWHQHU DQGSODWHVKDOOEH)DFWRU\0XWXDODSSURYHGIRUXVHWRJHWKHU)DVWHQHUVPXVWEHLQWHQGHGIRUVHFXUHPHQW RILQVXODWLRQLQWRDZRRGDQGPHWDOGHFNDQGEHDSSURYHGIRUXVHZLWKWKHLQWHQGHGLQVXODWLRQDQGE\ WKHPHPEUDQHV\VWHPPDQXIDFWXUHU)DVWHQHUVKDOOEHRIVXIILFLHQWOHQJWKWRSHQHWUDWHWKURXJKWKH UHTXLUHGOD\HUVRILQVXODWLRQFRYHUERDUGDQGLQWRWKHWRSRIWKHGHFNDPLQLPXPRIƎXQOHVV RWKHUZLVHUHTXLUHGE\WKHIDVWHQHUPDQXIDFWXUHU3XOORXWWHVWLQJRIWKHIDVWHQHULQWRWKHGHFNVZLOOEH UHTXLUHGIRUILQDOFRQILUPDWLRQRIIDVWHQHUVSDFLQJDQGSDWWHUQ * 7DSHUHG(GJH6WULSV&ORVHGFHOOSRO\LVRF\DQXUDWHULJLGLQVXODWLRQZLWKIRDPFRUHDQGIDFWRU\ ODPLQDWHGILEHUJODVVIDFHUVDFFHSWDEOHIRULQVWDOODWLRQE\PHFKDQLFDOIDVWHQLQJ)RDPFRUHVKDOO KDYHDIODPHVSUHDGRIRUOHVVSHU$670(DQGVKDOOKDYHDPLQLPXPGHQVLW\RISFI &RPSUHVVLYHVWUHQJWKVKDOOEHSVLPLQLPXPLQDFFRUGDQFHZLWK$670'7KLFNQHVVVKDOO EHƎƎ 522)0(0%5$1($1'$&&(6625,(6 $ 0HPEUDQH5RRIPHPEUDQHVKDOOEHDWKHUPRSODVWLFSRO\PHULFVLQJOHSO\SRO\YLQ\OFKORULGH 39& RU NHWRQH HWK\OHQH HVWHU .(( PHPEUDQH ZLWK ILEHUJODVV RU SRO\HVWHU UHLQIRUFHPHQW PHHWLQJ$670'39&RU'.((DQGWKHWHFKQLFDOPHPEUDQHSURSHUWLHVVSHFLILHG 7KHPHPEUDQHVKDOOEHDFFHSWDEOHIRUDGKHUHGDSSOLFDWLRQV0HPEUDQHFRORUZLOOEHFRQILUPHG GXULQJWKHSUHMREVXEPLWWDOSURFHVV)RUWKHSXUSRVHRIELGGLQJLWLVDQWLFLSDWHGWKDWWKHFRORU VHOHFWHGZLOOEHDVWDQGDUGFRORUVXFKDVZKLWHRURIIZKLWH $FFHSWDEOHPDQXIDFWXUHUVDQGSURGXFWVLQFOXGH D6DUQDILO*0,/PLQLPXP E)LEHUWLWH600,/ F,%5RRI6\VWHPV0,/PLQLPXP DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 7KHOLVWHGURRIPHPEUDQHPDQXIDFWXUHUVDUHSURYLGHGDVH[DPSOHVRIPDQXIDFWXUHUVDQG SURGXFWV WKDW W\SLFDOO\ PHHW WKH UHTXLUHPHQWV RI WKHVH VSHFLILFDWLRQV 7KH OLVWHG PDQXIDFWXUHUVDUHXVHGWRGHQRWHWKHTXDOLW\VWDQGDUGRISURGXFWGHVLUHGDQGDUHDFFHSWDEOH RQO\ LI WKH\ DUH DEOH WR PHHW WKH UHTXLUHPHQWV RI WKH VSHFLILFDWLRQV 5HTXHVWV IRU VXEVWLWXWLRQ RI DQRWKHU PDQXIDFWXUHU RU SURGXFW PXVW EH VXEPLWWHG LQ ZULWLQJ WR WKH (QJLQHHUIRUDSSURYDORUGLVDSSURYDOQROHVVWKDQWHQGD\VSULRUWRWKHELGGDWH 6XEPLWWHGUHTXHVWVPXVWLQFOXGHVXIILFLHQWGRFXPHQWDWLRQWRLQGLFDWHWKDWPDQXIDFWXUHU DQGRUSURGXFWVXEPLWWHGPHHWWKHUHTXLUHPHQWVRIWKHVHVSHFLILFDWLRQVDQGDUHHTXLYDOHQW WRWKHTXDOLW\RIWKRVHOLVWHGLQDFFRUGDQFHZLWK6HFWLRQ$PLQLPXPPHPEUDQH WKLFNQHVVRIPLOVLVUHTXLUHGIRUDOOPHPEUDQHV\VWHPVUHTXHVWHGDVVXEVWLWXWLRQV $FFHSWDQFHRIUHTXHVWHGVXEVWLWXWLRQVZLOOEHVROHO\DWWKHGLVFUHWLRQRIWKH'HVLJQHU 7KHPHPEUDQHSURSHUWLHVVKDOOPHHWRUH[FHHGWKHIROORZLQJPLQLPXPYDOXHV 39&)LEHUJODVV5HLQIRUFHG D7HQVLOH6WUHQJWK $670' OEI E(ORQJDWLRQDWEUHDN $670' 0'DQG&0' F/LQHDU'LPHQVLRQDO6WDELOLW\$670' G7HDU6WUHQJWK $670' OEI H:HLJKW&KDQJHDIWHULPPHUVLRQLQZDWHU$670' I6WDWLF3XQFWXUH5HVLVWDQFH$670' OEI K '\QDPLF3XQFWXUH5HVLVWDQFHIWOEISHU' 3DVV L 7KLFNQHVVRYHU6FULP PLO 39&3RO\HVWHU5HLQIRUFHG D%UHDNLQJ6WUHQJWK $670' [ E7HQVLOH6WUHQJWK $670' SVL F(ORQJDWLRQDWEUHDN $670' [ G/LQHDU'LPHQVLRQDO6WDELOLW\$670' H7HDU6WUHQJWK $670' [OEI $670' I:HLJKW&KDQJHDIWHULPPHUVLRQLQZDWHU$670' J6WDWLF3XQFWXUH5HVLVWDQFH$670' OEI K'\QDPLF3XQFWXUH5HVLVWDQFHIWOEISHU' 3DVV L7KLFNQHVVRYHU6FULP PLO .(( D 7KLFNQHVVRYHU6FULP PP E %UHDNLQJ6WUHQJWK$670'3URF% OEI F (ORQJDWLRQDW%UHDN$670' G 7HDULQJ6WUHQJWK$670'3URF% OEI H 6WDWLF3XQFWXUH5HVLVWDQFH$670' OEI I '\QDPLF3XQFWXUH5HVLVWDQFH$670' - % 0HPEUDQHDQG)ODVKLQJ$GKHVLYHV6KDOOEHORZ92&VROYHQWEDVHGDGKHVLYHVDVSURYLGHGE\WKH PDQXIDFWXUHUXQOHVVRWKHUZLVHUHTXHVWHGDQGDSSURYHGE\WKH'HVLJQHU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW & 8VHPHPEUDQHVKHHWIODVKLQJPDWHULDOVPHPEUDQHDQGIODVKLQJDGKHVLYHVIDVWHQHUVSODWHVSUH PROGHGSLSHYHQWIODVKLQJVIRDPURGVPHWDOWHUPLQDWLRQEDUVSUHIDEULFDWHGLQVLGHDQGRXWVLGH FRUQHUVVHDODQWVPDVWLFVVROYHQWVKRWDLUZHOGLQJHTXLSPHQWVHSDUDWLRQVKHHWVWDSHDQGRWKHU PDWHULDOVVSHFLILFDOO\UHFRPPHQGHGUHTXLUHGE\WKHPHPEUDQHPDQXIDFWXUHUDQGLQWHQGHGIRUXVH ZLWKWKHPHPEUDQHVSHFLILHGH[LVWLQJVXEVWUDWHFRQGLWLRQVREVHUYHGDQGDSSOLFDWLRQPHWKRGV VSHFLILHG0LQLPXPWKLFNQHVVRIIODVKLQJVVKDOOPDWFKWKDWRIWKHVSHFLILHGPHPEUDQHWRZKLFKLW ZLOOEHDSSOLHG5HIHUWR3DUDJUDSK$3URGXFWVVKDOOEHDSSURYHGIRULQFOXVLRQLQWKH VSHFLILHGPHPEUDQHPDQXIDFWXUHU¶VZDUUDQW\Exposed flashings, sealants, and other products provided must match the color of the adjacent roof membrane on which they will be installed. $'',7,21$/522)$&&(6625,(6 $:DON7UHDG8VHPDQXIDFWXUHUSURYLGHGVOLSUHVLVWDQWZDONWUHDGLQ\HOORZRUJUD\:DONWUHDGV PXVWEHFDSDEOHRIEHLQJKRWDLUZHOGHGWRWKHURRIPHPEUDQH0LQLPXPZLGWKRIZDONWUHDGVKDOO EH:DONWUHDGPDWHULDOPXVWEHFDSDEOHRIEHLQJFXWWRVL]HWRDFFRPPRGDWHH[LVWLQJURRI FRQGLWLRQV %/DS&OHDQHU6KDOOEHDFHWRQHDQGDSSURYHGE\WKHPDQXIDFWXUHU &6HDODQWV([SRVHG6KDOOEHORZPRGXOXVQRQVWDLQLQJRQHSDUWXUHWKDQHDQGRIJXQJUDGH FRQVLVWHQF\6HDODQWVKDOOEHHDVLO\ZRUNDEOHDQGVKDOOEHFDSDEOHRISURGXFLQJDVPRRWKDWWUDFWLYH ILQLVK)RUMRLQWVLQYHUWLFDOVXUIDFHVSURYLGH$670&7\SH6RU0*UDGH16&ODVV 8VH17)RUMRLQWVLQKRUL]RQWDOVXUIDFHVSURYLGH$670&7\SH6RU0*UDGH3&ODVV 8VH7:KHUHH[SRVHGFRORUVKDOOEHDSSURYHGE\2ZQHU$FFHSWDEOHPDQXIDFWXUHUVSURGXFWV VKDOOEH'\QDWURO,E\3HFRUD&RUSRUDWLRQRU6LNDIOH[DE\6LND&RUSRUDWLRQRUDSSURYHG HTXLYDOHQW0DNHVXUHPDWHULDOVDUHFRPSDWLEOHZLWKVXEVWUDWHV6HDODQWXVHGLQDQ\RWKHUORFDWLRQ VKDOOKDYHWKHW\SHDQGFRORUDSSURYHGE\WKH2ZQHU '6HDODQWV&RQFHDOHG)RUFRQFHDOHGVHDODQWVUHTXLUHGIRUGHWDLOVDQGQRWVSHFLILFDOO\SURYLGHGE\ RUUHFRPPHQGHGE\WKHURRIV\VWHPPDQXIDFWXUHUXVHEXW\OVHDODQWLIWDSHVHDODQWPLQLPXP ZLGHDQGWKLFNXQOHVVRWKHUZLVHVKRZQ (7DSH6HDODQW%XW\OWDSHVHDODQWPLQ´DQG´WKLFNXQOHVVRWKHUZLVHVKRZQRQWKHSURMHFW GUDZLQJV )%DWW,QVXODWLRQ6KDOOEHILEHUJODVVLQVXODWLRQDVSURYLGHGRUUHFRPPHQGHGE\WKHPDQXIDFWXUHU *9HQW 3LSH ([WHQVLRQV 6KDOO EH VFKHGXOH 39& FRQQHFWHG WR WKH H[LVWLQJ YHQWV ZLWK UXEEHU FRQQHFWRUVDQGVWDLQOHVVVWHHOFODPSV +6WDLQOHVVVWHHOFODPSDWSHQHWUDWLRQV3URYLGHDPLQZLGHVWDLQOHVVVWHHOSOXPEHUVFODPS ,3URYLGHRWKHUURRIV\VWHPDFFHVVRULHVQRWVSHFLILFDOO\OLVWHGEXWUHTXLUHGIRUWKHSURSHUDQG FRPSOHWHLQVWDOODWLRQRIWKHURRIV\VWHP -)RDPDW'UDLQ6KDOOEHVLPLODUWR*UHDW6WXIIDVPDQXIDFWXUHGE\'RZ .'UDLQ([WHQVLRQV6KDOOEHDQH[WHQVLRQNLWSURYLGHGE\WKHGUDLQPDQXIDFWXUHU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW /'UDLQ&ODPSLQJ5LQJVDQG6WUDLQHUV6KDOOEHFDVWLURQDQGPDWFKH[LVWLQJPDQXIDFWXUHUVL]HDQG SURILOH 0:DONZD\3DYHUV6KDOOEHWKLFN [ LQWHUORFNLQJUXEEHUSDYHUVZLWKDPROGHG³8´VKDSHG FRQILJXUDWLRQRQDOOIRXUVLGHV3DYHUVVKDOOZHLJKDPLQLPXPRISRXQGVSHUVTXDUHIRRW,QVWDOO DURXQGHTXLSPHQWVXSSRUWDQGZHLJKWHGJXDUGUDLOEDVHV&RORUWREHEODFN 13URYLGHVKHHWPHWDOIODVKLQJVFODGPHWDOWHUPLQDWLRQEDUVHWFLQDFFRUGDQFHZLWK6HFWLRQ 23RO\HWK\OHQH)RDP5RG&RPSUHVVLEOHURGRIQRQDEVRUSWLYHFORVHGFHOOPDWHULDOVL]HDVUHTXLUHGWR SURYLGHDVQXJILWDQGRUDVUHFRPPHQGHGE\WKHV\VWHPPDQXIDFWXUHUIRUWKHVSHFLILFXVH 33RXUDEOH6HDODQW3RFNHW$VVHPEO\6KDOOEHDSUHPDQXIDFWXUHGIRUPHGIUDPHIDEULFDWHGIURPD SRO\HVWHUUHVLQDQGDWZRSDUWXUHWKDQHSRXUDEOHVHDOHUDVPDQXIDFWXUHGE\&KHP/LQN2QO\XVH DVDSSURYHGE\(QJLQHHU 43LSH,QVXODWLRQ6KDOOPDWFKH[LVWLQJ 3$57 (;(&87,21 ,163(&7,21$1'685)$&(35(3$5$7,21 $ :KHUHLQVXODWLRQDQGFRYHUERDUGZLOOEHVHFXUHGWRWKHGHFNZLWKIDVWHQHUVDQGSODWHVSHUIRUPSXOO WHVWVSULRUWRWKHEHJLQQLQJRIURRIUHPRYDOWRWHVWWKHVXLWDELOLW\RIWKHSODQQHGIDVWHQHUVZLWKWKH H[LVWLQJURRIGHFNV3HUIRUPDPLQLPXPRIWHVWVLQWKHILHOGDQGZLWKLQƎRIWKHSHULPHWHU RIHDFKFRQWLJXRXVURRIVHFWLRQXQOHVVRWKHUZLVHUHFRPPHQGHGE\WKHPDQXIDFWXUHU7HVWVPXVW EHSHUIRUPHGLQWKHSUHVHQFHRI'HVLJQHU2ZQHU¶V5HSUHVHQWDWLYHRUE\DQLQGHSHQGHQWIDVWHQHU PDQXIDFWXUHU¶VUHSUHVHQWDWLYH7HVWUHVXOWVVKDOOEHSURYLGHGWRWKH'HVLJQHUSULRUWREHJLQQLQJ LQVWDOODWLRQRIWKHLQVXODWLRQV\VWHPDQGPD\DOORZIRUDUHGXFWLRQLQWKHVSHFLILHGIDVWHQLQJVSDFLQJ DQGSDWWHUQV % 5HPRYHWKHH[LVWLQJURRIV\VWHPPHPEUDQHLQVXODWLRQIODVKLQJVDQGRWKHULWHPVQHFHVVDU\IRU LQVWDOODWLRQRIWKHQHZURRIV\VWHPDQGGLVSRVHRIRIIVLWHLQDFFRUGDQFHZLWK6HFWLRQRI WKHVHVSHFLILFDWLRQV5HPRYHRQO\SRUWLRQVRIWKHH[LVWLQJURRILQJV\VWHPWKDWFDQEHFRYHUHGZLWK WKHQHZURRILQJPDWHULDOVGXULQJWKHVDPHGD\,QVWDOORQO\WKHDPRXQWRIURRIWKDWFDQEHFRYHUHG ZLWKWKHQHZURRILQJPDWHULDOVDQGPDGHZDWHUWLJKWGXULQJWKHVDPHZRUNGD\ & 9HULI\WKDWHOHPHQWVSHQHWUDWLQJWKHURRIDUHVROLGO\VHWDQGGRQRWKDYHYLVLEOHGDPDJH5DLVHDOO FXUEVDQGRWKHUSHQHWUDWLRQVWRSURYLGHYHUWLFDOIODVKLQJKHLJKWVRIDPLQLPXPRIDERYHWKH ILQLVKHGURRIVXUIDFH ' 5HSODFHSO\ZRRGDQGEORFNLQJDWORFDWLRQVZKHUHH[LVWLQJPDWHULDOVDUHGDPDJHGGHWHULRUDWHGRU GRQRWPHHWWKHVSHFLILHGUHTXLUHPHQWVLQDFFRUGDQFHZLWK6HFWLRQ ( 2UJDQL]HZRUNVXFKWKDWQRIRRWWUDIILFZLOORFFXURQFRPSOHWHGURRIDUHDV)RRWWUDIILFRYHUQHZO\ LQVWDOOHGPHPEUDQHVKDOOQRWEHDOORZHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ) 'R QRW DSSO\ URRILQJ PDWHULDOV WR VXUIDFHV ZKLFK DUH GDPS IUR]HQ GLUW\ GXVW\ RU RWKHUZLVH XQDFFHSWDEOHWRURRIV\VWHPPDQXIDFWXUHURU(QJLQHHU%HJLQQLQJLQVWDOODWLRQPHDQVDFFHSWDQFHRI H[LVWLQJFRQGLWLRQV ,168/$7,21&20326,7(,168/$7,21$1'&29(5%2$5',167$//$7,21 $,QVWDOO LQVXODWLRQ ERDUGV DQG FRYHUERDUG LQ DFFRUGDQFH ZLWK URRI PHPEUDQH PDQXIDFWXUHU¶V LQVWDOODWLRQLQVWUXFWLRQVDSSURYHGIDVWHQHUSDWWHUQVDQGWKLVVSHFLILFDWLRQVHFWLRQ,QVWDOOQRPRUH LQVXODWLRQWKDQFDQEHFRYHUHGZLWKURRIPHPEUDQHDQGFRPSOHWHGEHIRUHWKHHQGRIWKHGD\¶VZRUN RUEHIRUHWKHRQVHWRILQFOHPHQWZHDWKHU %%DVH/D\HU,QVXODWLRQ ,QVWDOO WKH IODW DQG WDSHUHG LQVXODWLRQ ERDUGV LQ DFFRUGDQFH ZLWKWKHURRIPHPEUDQH PDQXIDFWXUHU¶V LQVWDOODWLRQ LQVWUXFWLRQV DSSURYHG IDVWHQHU DQG DGKHVLYH SDWWHUQV WKH DSSURYHGWDSHUHGLQVXODWLRQOD\RXWDQGWKLVVSHFLILFDWLRQVHFWLRQ,QVWDOOQRPRUHLQVXODWLRQ WKDQFDQEHFRYHUHGZLWKURRIPHPEUDQHDQGFRPSOHWHEHIRUHWKHHQGRIWKHGD\¶VZRUNRU EHIRUHWKHRQVHWRILQFOHPHQWZHDWKHU 7KHORQJGLPHQVLRQRIERDUGVKDOOEHLQVWDOOHGSHUSHQGLFXODUWRWKHSODQQHGOD\RXWRIWKH PHPEUDQHVHDPV6WDJJHUHQGMRLQWVRIDGMDFHQWERDUGVDPLQLPXPRI 0HFKDQLFDOO\IDVWHQWKHEDVHOD\HUDQGWDSHUHGLQVXODWLRQWRWKHH[LVWLQJGHFNDWDPLQLPXP UDWHRIRQHIDVWHQHUDQGSODWHHYHU\VTXDUHIHHWRIPD[LPXPFRQWULEXWRU\DUHDSHU IDVWHQHU DSSUR[LPDWHO\ IDVWHQHUV SHU [ ERDUG LQ WKH ILHOG RI WKH URRI XQOHVV RWKHUZLVHDSSURYHGE\WKH'HVLJQHUEDVHGRQSXOORXWWHVWGDWD$GGLWLRQDOIDVWHQHUVDQG SODWHVVKDOOEHLQVWDOOHGDWSHULPHWHUVDQGFRUQHUVDVIROORZVPLQLPXPIDVWHQHUVSHU ¶[¶ERDUGLQWKHSHULPHWHUVDQGPLQLPXPIDVWHQHUVSHU¶[¶ERDUGLQWKHFRUQHUV )DVWHQHUUDWHVVKRXOGEHLQFUHDVHGRUPD\EHGHFUHDVHGEDVHGRQSXOORXWWHVWYDOXHVDQG DSSURYDOVIURPWKHURRIV\VWHPPDQXIDFWXUHUDQG'HVLJQHU )DVWHQHUVVKDOOEHSRVLWLRQHGQRFORVHUWKDQIURPWKHSHULPHWHURIWKHERDUGIRUD¶[¶ ERDUGDQGQRFORVHUWKDQƎIURPWKHSHULPHWHUIRUD¶[¶ERDUGDQGVKDOOIROORZ LQVXODWLRQPDQXIDFWXUHU¶VIDVWHQHUSDWWHUQV )DVWHQHUVVKDOOEHLQVWDOOHGDVUHFRPPHQGHGE\WKHPDQXIDFWXUHU,IUHTXLUHGIRUSURSHU IDVWHQHULQVWDOODWLRQSUHGULOOWKURXJKWKHLQVXODWLRQDQGFRYHUERDUG'RQRWXQGHUGULYHRU RYHUGULYHIDVWHQHUVDYRLGFXSSLQJRISODWHV ,QVWDOODGGLWLRQDOIDVWHQHUVDQGSODWHVDWWKHSHULPHWHUDQGFRUQHUV7KHSHULPHWHULV PLQLPXPRIƍZLGHIRU5RRI$UHD$ƍZLGHIRU5RRI$UHD%DQGWKHFRUQHUVDUHD PLQLPXPRIƍ[ƍIRU5RRI$UHD$DQGƍ[ƍIRU5RRI$UHD%9HULI\SHULPHWHUDQG FRUQHUGLPHQVLRQVZLWKWKHPDQXIDFWXUHU &$GKHUHG&RPSRVLWH%RDUGDQG&RYHUERDUG6DGGOHV&ULFNHWV &RPSRVLWHERDUGVKDOOEHVHWLQWRDFRQWLQXRXVZLGHEHDGRIDGKHVLYHDWDPLQLPXPUDWH RIRQHOLQHDUIRRWRIDGKHVLYHIRUHYHU\RQHVTXDUHIRRWRIERDUGLQWKHILHOGRIWKHURRI7KH LQVXODWLRQDGKHVLYHVKDOOEHLQVWDOOHGDWDPD[LPXPRIIURPWKHSHULPHWHURIWKHERDUG'R QRWDSSO\WKHDGKHVLYHXQOHVVWKHWHPSHUDWXUHLV)DQGULVLQJ,QFUHDVHDGKHVLYHUDWHVLQ WKHURRISHULPHWHUDQGFRUQHUDUHDVDVGHILQHGRQWKHGUDZLQJVDQGLQDFFRUGDQFHZLWKWKH V\VWHPPDQXIDFWXUHU¶VGHVLJQUHFRPPHQGDWLRQVPD[LPXPVSDFLQJLQSHULPHWHUDQGFRUQHUV RIDQGUHVSHFWLYHO\XQOHVVRWKHUZLVHDSSURYHG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 'RQRWDSSO\WKHDGKHVLYHXQOHVVWKHWHPSHUDWXUHLVGHJUHHV)DKUHQKHLWDQGULVLQJ $OORZDGKHVLYHWRULVHDSSUR[LPDWHO\DQGVHWERDUGVLQWRDGKHVLYH&RQWLQXHWRLQVWDOO ERDUGVLQWRDGKHVLYH 3ODFHGRQRWVOLGHERDUGVRQWRWKHDGKHVLYHDQGZDONRQWKHERDUGVWRVSUHDGWKHDGKHVLYH IRUPD[LPXPFRQWDFW(YHQO\ZHLJKWWKHERDUGVWRKROGWKHPLQFRQWDFWZLWKWKHGHFN XQWLOWKHVHFRQGZDONLQJLVSHUIRUPHGPLQLPXPPLQXWHVDIWHULQLWLDOZDONLQ $YRLGH[FHVVLYHVFRULQJRIWKHERDUGVDWXQHYHQGHFNFRQGLWLRQV3URYLGHDGGLWLRQDOZHLJKW DWDUHDVUHTXLULQJDGGLWLRQDODGKHVLRQWLPH ':KHQKDQGOLQJULJLGLQVXODWLRQERDUGVDQGFRYHUERDUGWDNHFDUHQRWWRUXSWXUHGDPDJHWKHIDFHUVRI WKHERDUGV%XWWHGJHVRIERDUGVZLWKRXWIRUFLQJMRLQWV&XWERDUGVWRILWQHDWO\WRSHULPHWHU EORFNLQJDQGSHQHWUDWLRQVWKURXJKURRI&XWKROHVLQWKHLQVXODWLRQIRUURXQGSHQHWUDWLRQVGRQRW LQVWDOOSLHFHV0LWHUERDUGHGJHVLIQHFHVVDU\IRUSURSHUILWDWWUDQVLWLRQVLQGHFNVORSH)LOOLQJDSV EHWZHHQ ERDUGV JUHDWHU WKDQ ZLWK LQVXODWLRQ $YRLG WKH XVH RI LQVXODWLRQ SLHFHV ZLWK GLPHQVLRQVOHVVWKDQƎ (6WDJJHUERDUGMRLQWVDPLQLPXPRIƎWKURXJKRXWHDFKOD\HUDQGEHWZHHQOD\HUV ),QVXODWLRQDQGFRPSRVLWHVKDOOEHLQVWDOOHGWRPDLQWDLQWKHH[LVWLQJVORSHRIWKHURRIV\VWHP 7DSHUHGLQVXODWLRQDWGUDLQVXPSVDQGLVRODWHGDUHDVRIVXSSOHPHQWDOWDSHUHGLQVXODWLRQDUHVKRZQ RQWKHGUDZLQJVDQGVKRXOGEHSURYLGHGWRSURPRWHSRVLWLYHGUDLQDJH&KHFNLQVXODWLRQVXUIDFHVDV HDFKOD\HULVLQVWDOOHGWRHQVXUHWKDWQRXQDQWLFLSDWHGGHIOHFWLRQVFDPEHUVJDSVRURWKHUFRQGLWLRQV H[LVWWKDWPD\LPSHGHSURSHUGUDLQDJH,QVWDOODGGLWLRQDOWDSHUHGLQVXODWLRQDWLVRODWHGORFDWLRQVLI UHTXLUHGWRFRUUHFWRULPSURYHGUDLQDJHFRQGLWLRQVLQDFFRUGDQFHZLWKWKHHVWLPDWHGTXDQWLW\RI ZRUN *1LJKWWLPHWLHLQVVKDOOKDYHWHPSRUDU\VWDJJHULQSODFHDQGVKRXOGXVH³ILOOLQ´FRXUVHVWKDWFDQEH UHPRYHGZKHQVXEVHTXHQWZRUNEHJLQV +6ZHHSDOOORRVHGHEULVIURPWKHVXEVWUDWHEHWZHHQOD\HUVRILQVXODWLRQLQVWDOODWLRQDQGSULRUWR LQVWDOOLQJWKHPHPEUDQH 0(0%5$1(6<67(0,167$//$7,21 $ 3RVLWLRQVLQJOHSO\PHPEUDQHRYHUURRIDUHDZLWKRXWVWUHWFKLQJ$OORZPHPEUDQHWRUHOD[IRUD PLQLPXPRIRQHKDOIKRXUSULRUWRDQ\IDVWHQLQJDGKHULQJRUVHDPLQJ6KLQJOHDOOODSVLQWKH GLUHFWLRQRIZDWHUIORZVWDUWLQJDWWKHGUDLQRUORZSRLQWDQGZRUNLQJXSVORSH([WHQGWKHILHOG VKHHWDPLQLPXPRIXSWKHYHUWLFDODQGIDVWHQWKHPHPEUDQHDWWKHEDVHRISDUDSHWZDOOVFXUEV HWFDPLQLPXPRIRQFHQWHU % )XOO\$GKHUHG,QVWDOODWLRQ3RVLWLRQWKHPHPEUDQHWRDOORZIRUH[SRVXUHRIWKHXQGHUVLGHRIWKH VKHHW$SSO\DFRQWLQXRXVFRYHUDJHRIPHPEUDQHDGKHVLYHWRWKHXQGHUVLGHRIWKHPHPEUDQHDQG DPLUURUHGDUHDRIWKHSUHSDUHGVXEVWUDWHVXUIDFH$GKHVLYHFRYHUDJHVKDOOEHDPLQLPXPRI VT IW SHU JDOORQ QHW FRYHUDJH IRU WKH PHPEUDQH DQG PLUURUHG VXEVWUDWH FRPELQHG RU DV UHFRPPHQGHGE\WKHURRIV\VWHPPDQXIDFWXUHU'RQRWDOORZWKHDGKHVLYHZLWKLQDPLQLPXPRI IURPWKHHGJHRIWKHPHPEUDQH$YRLGKROLGD\VJOREVDQGSXGGOHV)ROORZWKHPDQXIDFWXUHU¶V LQVWUXFWLRQVIRUGHWHUPLQLQJVXIILFLHQWDGKHVLYHWDFNGU\QHVVIRUPDWLQJPHPEUDQHZLWKVXEVWUDWH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 3ODFHPHPEUDQHRQWRWKHVXEVWUDWHVXUIDFHDYRLGLQJZULQNOHVDQGDLUSRFNHWV%URRPWKHDGKHUHG SRUWLRQRIWKHPHPEUDQHWRLQVXUHIXOOFRQWDFWZLWKWKHVXEVWUDWHDQGFRPSOHWHSURFHVVE\ILUPO\ SUHVVLQJ WKH DGKHUHG PHPEUDQH LQWR SODFH ZLWK D ZHLJKWHG UROOHU LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHU¶VLQVWUXFWLRQV $GKHVLYHLVWREHDSSOLHGXVLQJUROOHUVLQDFFRUGDQFHZLWKWKHURRIV\VWHPPDQXIDFWXUHU¶V LQVWUXFWLRQVDQGUHFRPPHQGDWLRQV'RQRWSRXUDGKHVLYHRXWRIEXFNHWVWRUROOLQ7KH DPRXQWRIPHPEUDQHDQGVXEVWUDWHWKDWFDQEHFRYHUHGZLWKDGKHVLYHDWRQHWLPHPXVWEH GHWHUPLQHGE\WKHPHWKRGRIDSSOLFDWLRQWKHDPELHQWWHPSHUDWXUHKXPLGLW\DQGQXPEHU RIZRUNHUVDYDLODEOH2QO\DSSO\DGKHVLYHVWRDUHDVZKLFKFDQEHFRPSOHWHO\FRYHUHGZLWK PHPEUDQHZLWKLQWKHVDPHZRUNGD\ )RUDGMDFHQWPHPEUDQHUROOVSURYLGHDPLQLPXPODSPD[LPXPODSDWVXEVHTXHQW DGMDFHQW UROOV RI PHPEUDQH 'R QRW DSSO\ DGKHVLYH WR WKH ODS ³VHDP´ DUHDV RI WKH PHPEUDQHWKDWZLOOEHKRWDLUZHOGHG 7UDFNDQGUHFRUGWKHDPRXQWRISDLOVRIDGKHVLYHXVHGSHUVTXDUHIRRWDUHDE\VDYLQJDQG GDWLQJWKHWRSVRIWKHDGKHVLYHSDLOV1RWHLQGDLO\ORJVWKHDUHDRIPHPEUDQHLQVWDOOHG HDFKGD\.HHSWKHGDWHGOLGVIURPHDFKGD\RIPHPEUDQHLQVWDOODWLRQXQWLOWKH'HVLJQHU DQGRU2ZQHUFDQYHULI\FRQIRUPDQFHWRWKHVSHFLILHGDGKHVLYHUDWH & 2QFHWKHPHPEUDQHKDVEHHQDGKHUHGWRWKHVXEVWUDWHFOHDQDUHDRIWKHWZRPHPEUDQHVKHHWVWR EHVHDPHGZLWKDSSURYHGVHDPFOHDQHULQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU¶VLQVWUXFWLRQV$OORZ FOHDQLQJVROYHQWVWRGLVVLSDWHDQGWKHVHDPVWRGU\SULRUWRLQLWLDWLQJDQ\ILHOGZHOGLQJ ' +RWDLU ZHOG PHPEUDQH VHDP XVLQJ DQ DXWRPDWLF KRW DLU ZHOGHU WR SURYLGH D FRQWLQXRXV KRPRJHQHRXVZHOGDPLQLPXPRILQZLGWKKDQGKHOGZHOGHUVWREHXVHGIRUVPDOODUHDVDQG UHSDLUVRQO\ZLWKDPLQLPXPRIZLGWKKHDWZHOG:HOGLQJHTXLSPHQWXVHGPXVWEHDFFHSWDEOH WRWKHZDUUDQWLQJPDQXIDFWXUHU3URYLGHDGHGLFDWHGJHQHUDWRUIRUVHDPLQJHTXLSPHQW0DUNDQG SDWFKDUHDZKHUHDXWRPDWLFZHOGHULVVWRSSHG ( 2QFHVHDPDUHDKDVFXUHGSUREHWKHHQWLUHOHQJWKRIODSHGJHZLWKDQDSSURYHGVHDPSURELQJWRRO IRUYRLGVRUVHDPGHILFLHQFLHV5HSDLUGHILFLHQFLHVVDPHGD\VHDPLVSUREHG3HUIRUPGHVWUXFWLYH WHVWLQJ RI VHDPV SHHO WHVWV DW WKH IUHTXHQFLHV DQG WHVW VL]HV UHTXLUHG E\ WKH PHPEUDQH PDQXIDFWXUHU5HSDLUWHVWORFDWLRQV )/$6+,1*6 $ ,QVWDOO IODVKLQJ PHPEUDQH ZKHUH VKRZQ RQ WKH GUDZLQJ WR SURYLGH ZDWHUWLJKW WUDQVLWLRQV DW SHULPHWHU GHWDLOV WUDQVLWLRQV DQG DW LWHPV SHQHWUDWLQJ PHPEUDQH LQ DFFRUGDQFH ZLWK SURMHFW VSHFLILFDWLRQVDQGGUDZLQJVDQGWKHPDQXIDFWXUHU¶VLQVWDOODWLRQLQVWUXFWLRQV&RQILUPXVHRISURSHU IODVKLQJFRORUWRPDWFKWKHDGMDFHQWPHPEUDQH % )ODVKLQJPHPEUDQHVKDOOEHIXOO\DGKHUHGDQGIDVWHQHGWRSHQHWUDWLRQVXEVWUDWHVDQGKHDWZHOGHG WRWKHDGMDFHQWPHPEUDQHDVVKRZQRQWKHSURMHFWGUDZLQJV:KHUHDGKHUHGIODVKLQJVKRXOGEH LQVWDOOHGLQDGKHVLYHDVVKRZQRQWKHGUDZLQJVRUUHTXLUHGE\WKHPDQXIDFWXUHULQVXIILFLHQW TXDQWLW\WRHQVXUHWRWDODGKHVLRQ8VHVXEVWUDWHSULPHUVDVUHFRPPHQGHGE\WKHURRIPDQXIDFWXUHU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ,IWKHPDQXIDFWXUHUZLOOQRWDOORZIODVKLQJWREHDGKHUHGRYHUELWXPHQUHVLGXHWKHFRQWUDFWRUZLOO LQVWDOODOD\HURISO\ZRRGRQWKHZDOOVDQGWREHLQFOXGHGLQWKHLUELG & 6HFXUHWKHPHPEUDQHDWWKHEDVHRIH[SDQVLRQMRLQWVZDOOWUDQVLWLRQVFXUEVHWFRQFHQWHU XQOHVV RWKHUZLVH QRWHG RQ WKH GHWDLO GUDZLQJV RU VSHFLILHG E\ WKH PHPEUDQH PDQXIDFWXUHU 6HFXUHPHQWRIWKHPHPEUDQHSHULPHWHUWRWKHGHFNLVDOVRDFFHSWDEOH ' ,QVWDOO³7´SDWFKHVDWDOOLQWHUVHFWLRQV,QVWDOOSDWFKHVDWDOODXWRPDWLFZHOGHU³VWDUWV´DQG³VWRSV´ ORFDWLRQVVKRXOGEHPDUNHGDVVHDPLQJLVEHLQJSHUIRUPHG ( &OHDQDOOSLSHVFXUEVZDOOVDQGRWKHUH[LVWLQJVXEVWUDWHVWRUHPRYHGHEULVDQGSUHYLRXVPDWHULDOV SULRUWRLQVWDOODWLRQRIQHZIODVKLQJV ) 8VHSUHIRUPHGFRUQHUVRQDOOLQVLGHDQGRXWVLGHFRUQHUIODVKLQJV * 9HUWLFDOIODVKLQJVKDOOEHWHUPLQDWHGDPLQLPXPRIDERYHWKHURRIVXUIDFH)RUIODVKLQJKHLJKWV ORZHUWKDQWKHFRQWUDFWRUPXVWHLWKHUPDNHPRGLILFDWLRQVWRWKHH[LVWLQJSHQHWUDWLRQRIWUDQVLWLRQ WRDOORZIRUSURSHUYHUWLFDOIODVKLQJKHLJKWRUVKDOOREWDLQZULWWHQDSSURYDOIURPWKHPDQXIDFWXUHU IRUUHYLHZE\WKH(QJLQHHU + )ODVKLQJKLJKHUWKDQƎZLOOUHTXLUHVXSSOHPHQWDOVHFXUHPHQWLQVWDOOHGLQDFFRUGDQFHZLWKWKH PDQXIDFWXUHU¶VUHTXLUHPHQWV , 3UREHDQGUHSDLUDOOVHDPVEHWZHHQWKHIODVKLQJDQGWKHPHPEUDQHWKHGD\RILQVWDOODWLRQ8VH SURELQJPHWKRGVDQGWRROVUHFRPPHQGHGE\WKHURRIV\VWHPPDQXIDFWXUHU 0(0%5$1(3$7&+(6 $ 3DWFKHVVKDOOQRWEHOHVVWKDQE\3DWFKHVVKDOOEHFHQWHUHGRYHUGDPDJHGDUHDDQGH[WHQGD PLQLPXPRIEH\RQGWKHSHULPHWHURIGDPDJHGDUHD5RXQGFRUQHUVRISDWFKHVDQGIXOO\VHDO % 2WKHUWKDQWKHSDWFKHVUHTXLUHGE\WKHPHPEUDQHPDQXIDFWXUHUDWFULWLFDOORFDWLRQVVXFKDV³7´ LQWHUVHFWLRQVRIVHDPVRUFRUQHUVRIFXUEHGHTXLSPHQWDWZHOGWHVWFXWVDQGDWZHOGHUVWDUWVDQG VWRSVWKHQXPEHURIDOORZDEOHSDWFKHVGXHWRZHOGLVVXHVRUPHPEUDQHGDPDJHVVKDOOEHOLPLWHG WRSHUVTXDUHIHHWRQWKHPDLQURRIDUHDV,IWKHQXPEHURISDWFKHVH[FHHGVWKLVDPRXQW WKH2ZQHURU'HVLJQHUZLOOUHYLHZWKHLQVWDOODWLRQDQGWKHFDXVHIRUSDWFKHVDQGPD\UHTXLUHWKDW WKHDIIHFWHGURRIVHFWLRQEHUHSODFHGLQLWVHQWLUHW\ 3,3()/$6+,1* $ )RUPDQGLQVWDOOQHZSLSHIODVKLQJYHQWSLSHIODVKLQJHWFLQDFFRUGDQFHZLWKWKHGHWDLOGUDZLQJV 3UHIDEULFDWHGERRWVIRUSLSHSHQHWUDWLRQVDVVXSSOLHGE\WKHURRIPHPEUDQHPDQXIDFWXUHUVKDOO EHWKHSUHIHUUHGIODVKLQJDQGVKDOOEHXVHGZKHQSRVVLEOHIRUYHQWSLSHIODVKLQJ:KHQDERRW LQVWDOODWLRQLVQRWIHDVLEOHILHOGZUDSWKHSLSHSHQHWUDWLRQLQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU V UHTXLUHPHQWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW % )ODQJHVRISLSHIODVKLQJVVKDOOEHDPLQLPXPRIƎLQZLGWKDQGVKDOOEHIXOO\KHDWZHOGHGWRWKH PHPEUDQH3URYLGHVHFXUHPHQWRIWKHPHPEUDQHWRWKHGHFNDURXQGSLSHSHQHWUDWLRQVLIDVUHTXLUHG E\WKHPHPEUDQHPDQXIDFWXUHU3URYLGHUHTXLUHGVHSDUDWLRQWDSHVHDODQWVDQGRWKHUDFFHVVRULHV IRUSURSHUGHWDLOLQVWDOODWLRQ & )RUKRWSLSHKLJKWHPSHUDWXUHSHQHWUDWLRQIODVKLQJV,IDQH[LVWLQJVOHHYHLVDYDLODEOHDQGSURYLGHV DVDFFHSWDEOHVXEVWUDWHIRUWKHQHZIODVKLQJLWPD\EHUHXVHG,IDQDGHTXDWHVOHHYHLVQRWDYDLODEOH LQVWDOODQHZPHWDOVOHHYHDVVKRZQRQWKHGHWDLOGUDZLQJV '5$,16 $ 9HULI\WKDWH[LVWLQJGUDLQVDUHFOHDUDQGIUHHIORZLQJSULRUWRWKHEHJLQQLQJRIZRUNDQGDWWKH FRPSOHWLRQRIZRUN$Q\FORJJHGRUREVWUXFWHGGUDLQVVKDOOEHEURXJKWWRWKHDWWHQWLRQRIWKH 2ZQHU'UDLQVFORJJHGRUREVWUXFWLYHDIWHUWKHEHJLQQLQJRIZRUNZLOOEHFOHDUHGZLWKQRFRVWWR WKH2ZQHU % 5HSODFHEURNHQPLVVLQJRUGDPDJHGGUDLQFRPSRQHQWV5HSODFHSODVWLFFODPSLQJULQJVDQGGUDLQ VWUDLQHUVZLWKFDVWLURQVWUDLQHUV & 5HPRYHWKHH[LVWLQJPHPEUDQHDURXQGWKHGUDLQ,QVWDOOQHZPHPEUDQHDQGGUDLQWDUJHWIODVKLQJ ' ,QVWDOOVHDODQWEHWZHHQWKHQHZPHPEUDQHDQGGUDLQERZO3URYLGHFRPSUHVVLRQRQWKHVHDODQW ( /DSVVKDOOEHORFDWHGDPLQLPXPRIIURPWKHHGJHRIWKHGUDLQVXPSDQGƎIURPWKHHGJHRI WKHGUDLQERZO ) &XWWKHPHPEUDQHDPLQLPXPRIEH\RQGWKHFODPSLQJULQJDQGLQGLDPHWHUODUJHUWKDQWKH GUDLQSLSH ,167$//$7,212)522)$&&(6625,(6 $ :DON7UHDG5XEEHU3DYHUV'HWHUPLQHORFDWLRQSDWKRIZDONWUHDGLQDGYDQFH/D\RXWZDONWUHDG WR DYRLG LQVWDOODWLRQ RI WKH WUHDG RYHU PHPEUDQH DQG IODVKLQJ VHDPV &OHDQ PHPEUDQH LQ DFFRUGDQFHZLWKWKHPDQXIDFWXUHU¶VUHFRPPHQGDWLRQV$GKHUHILHOGRIZDONWUHDGWRWKHGHFNDQG KRWDLUZHOGDURXQGHQWLUHSHULPHWHURIZDONWUHDG/RRVHOD\UXEEHUSDYHUVRYHUZDONWUHDGZKHUH QRWHGRQWKHGUDZLQJV % 6HDODQWVDQG3ULPHUV,QVWDOOJXQQDEOHDQGWDSHVHDODQWVSULPHUVDQGRWKHUDFFHVVRU\LWHPVLQ DFFRUGDQFHZLWKWKHUHFRPPHQGDWLRQVRIWKHZDUUDQWLQJPDQXIDFWXUHU & ,QVWDOOHGJHPHWDOPHPEUDQHFODGPHWDOWULPDQGFRXQWHUIODVKLQJVLQDFFRUGDQFHZLWK6HFWLRQ ' ,QVWDOORWKHUURRIV\VWHPDFFHVVRULHVDVVKRZQRQWKHGHWDLOGUDZLQJVRUUHTXLUHGE\WKHPHPEUDQH PDQXIDFWXUHULQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU¶VLQVWUXFWLRQV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ),(/'48$/,7<&21752/ $ 7KH&RQWUDFWRULVUHVSRQVLEOHIRULQLWLDWLQJDQGPDLQWDLQLQJGDLO\H[HFXWLRQRIDTXDOLW\FRQWURO SURJUDPWKDWZLOOLQFOXGHEXWLVQRWOLPLWHGWRVXSHUYLVLRQE\WKHMREIRUHPDQRUVXSHUYLVRUGXULQJ VXEVWUDWH SUHSDUDWLRQ LQVWDOODWLRQ RI LQVXODWLRQ DQG FRYHUERDUG LQVWDOODWLRQ RI IDVWHQHUV DQG DGKHVLYHVFDOLEUDWLRQRIKHDWZHOGLQJHTXLSPHQWDQGSURELQJRIKHDWZHOGHGVHDPV % &RUUHFW GHIHFWV DQG LUUHJXODULWLHV DV GLUHFWHG E\ (QJLQHHU RU 2ZQHU¶V UHSUHVHQWDWLYH ,I LQFRQVLVWHQF\LQWKHRYHUDOOTXDOLW\RIWKHLQVWDOODWLRQLVREVHUYHGRUVXVSHFWHGE\WKH(QJLQHHU 2ZQHURUURRIV\VWHPPDQXIDFWXUHUZRUNVKDOOVWRSXQWLOSURSHUFRUUHFWLYHDFWLRQVDUHWDNHQWR HQVXUHFRQWLQXLW\RIWKHZRUNPDQVKLS & 5HTXLUHUHSUHVHQWDWLYHRIPHPEUDQHPDQXIDFWXUHUWRPDNHLQVSHFWLRQVDVQHFHVVDU\PLQLPXPRI WKUHHYLVLWVDQGILQDOLQVSHFWLRQWRTXDOLI\URRILQJV\VWHPIRUPDQXIDFWXUHU¶VZDUUDQW\VSHFLILHGLQ WKLVVHFWLRQ5HIHUWR6HFWLRQIRUDGGLWLRQDOUHTXLUHPHQWV ' ,QIRUP(QJLQHHURIDOOPDQXIDFWXUHULQVSHFWLRQVDPLQLPXPRIKRXUVEHIRUHLQVSHFWLRQLVWR WDNHSODFH3URYLGHDFRS\RIPDQXIDFWXUHU¶VLQVSHFWLRQUHSRUWVWRWKH(QJLQHHU ( 7KH(QJLQHHUZLOOWDNHSHULRGLFWHVWFXWVLQWKHODSVWRGHWHUPLQHODSLQVWDOODWLRQTXDOLW\'HIHFWLYH DUHDVZLOOEHUHSDLUHGE\WKHFRQWUDFWRU -2%$1':($7+(5&21',7,216 $ 6XVSHQGDOODSSOLFDWLRQDQGLQVWDOODWLRQDFWLYLWLHVGXULQJLQFOHPHQWZHDWKHUDQGFRQILUPSURSHU WHPSHUDWXUHDQGKXPLGLW\UDQJHVSULRUWRDSSOLFDWLRQRIVHDODQWVDGKHVLYHVDQGRWKHUSURGXFWV UHOLDQWXSRQWHPSHUDWXUHKXPLGLW\IRUSURSHUFXULQJ % 3URWHFWWKHURRIGHFNDQGLQVXODWLRQIURPPRLVWXUHE\SURYLGLQJZDWHUFXWRIIVDWWKHHQGRIHDFK GD\¶VZRUNRUZKHQWKHZHDWKHULVWKUHDWHQLQJ)DLOXUHWRSURWHFWWKHGHFNDQGURRILQJIURP PRLVWXUHZLOOUHVXOWLQWKHUHPRYDORIGDPDJHGPDWHULDOVFRQWDLQLQJH[FHVVLYHPRLVWXUH5HPRYH ZDWHUFXWRIIVSULRUWRVWDUWRIQHZZRUN&XWEDFNDVDFULILFLDOVHFWLRQRIPHPEUDQHDQGLQVXODWLRQ DGMDFHQWWRDQGFRQWDPLQDWHGE\WKHZDWHUFXWRIIDQGGLVSRVHRIRIIVLWH/D\RXWRILQVXODWLRQ ERDUGVDWQLJKWO\WLHLQVPXVWEHSODQQHGWRDOORZIRUVWDJJHULQJRIWKHLQVXODWLRQERDUGVDFURVV WKHVHMRLQWV & 6WULFWO\OLPLWIRRWWUDIILFDQGPDWHULDOVWRUDJHRQFRPSOHWHGURRIVXUIDFHV5RRIUHSODFHPHQWPXVW EH VHTXHQFHG WR OLPLW IRRW DQG HTXLSPHQW WUDIILF RYHU DUHDV RIQHZ URRI V\VWHPPHPEUDQH LQVWDOODWLRQ:KHUHIRRWDQGHTXLSPHQWWUDIILFRYHUWKHQHZO\LQVWDOOHGURRIV\VWHPFDQQRWEH DYRLGHGDQGZKHUHVKHHWPHWDOLQVWDOODWLRQVDUHRFFXUULQJRYHUQHZPHPEUDQHLQVWDOODWLRQVSURYLGH PLQLPXPƎWKLFNULJLGLQVXODWLRQERDUGDQGƎWKLFNSO\ZRRGZDONZD\VWRSURWHFWWKHQHZURRI V\VWHP 7(0325$5<:$7(5&872))6$1':$7(57,*+1(66'85,1*&216758&7,21 $ ,QVWDOODWHPSRUDU\ZDWHUWLJKWVHDOEHWZHHQWKHVHFWLRQRIWKHQHZURRIFRPSOHWHGDQGWKHDGMDFHQW H[LVWLQJURRIV\VWHPDWWKHHQGRIHDFKZRUNGD\7KHQHZURRIV\VWHPVKDOOEHVHDOHGVRWKDWZDWHU DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ZLOO QRW EH DOORZHG WR WUDYHO XQGHU WKH QHZ RU H[LVWLQJ URRI V\VWHP :KHQ ZRUN UHVXPHV FRQWDPLQDWHGPDWHULDOVIURPWKHZDWHUFXWRIILQFOXGLQJPHPEUDQHDQGLQVXODWLRQVKDOOEHUHPRYHG IURPWKHZRUNDUHDDQGGLVSRVHGRIRIIVLWH1RQHRIWKHVHPDWHULDOVVKDOOUHPDLQRUEHUHXVHGLQ WKHQHZV\VWHPLQVWDOODWLRQ7KHLQVXODWLRQDWWKHWHPSRUDU\FXWRIIVKDOOEHPRGLILHGWRSURYLGHD WRRWKHGLQVWDOODWLRQRIQHZLQVXODWLRQWRSUHYHQWDQLQOLQHYHUWLFDOJDSDWFXWRIIORFDWLRQV % 7KH&RQWUDFWRUVKDOOSURYLGHWKHRQVLWHODERUQHFHVVDU\WRYLVXDOO\FKHFNWKHLQWHULRUFRQGLWLRQVRI WKHEXLOGLQJDWWLPHVZKHQLQFOHPHQWZHDWKHURFFXUVVWURQJWKXQGHUVWRUPVKXUULFDQHVWURSLFDO GHSUHVVLRQVH[WHQGHGUDLQHYHQWVDQGWKHZRUNFUHZLVQRWRQVLWHLQFOXGLQJDIWHUZRUNKRXUV ZHHNHQGVDQGKROLGD\V'LVFRYHU\RIZDWHUHQWU\LQWRWKHEXLOGLQJGXULQJLQFOHPHQWZHDWKHUPXVW EHLPPHGLDWHO\IROORZHGE\DFWLRQE\WKH&RQWUDFWRURUUHSUHVHQWDWLYHWRSUHYHQWRUOLPLWGDPDJH RUHIIHFWRQLQWHULRUILQLVKHVDQGPDWHULDOV,PPHGLDWHSUHYHQWDWLYHDFWLRQVVKDOOEHIROORZHG SURPSWO\E\WHPSRUDU\UHSDLUDFWLYLWLHVWRUHGXFHRUVWRSZDWHUHQWU\LQWRWKHURRIV\VWHP & 7KH2ZQHUPD\PDNHWHPSRUDU\UHSDLUVRUWDNHWHPSRUDU\DFWLRQWRSUHYHQWZDWHUIURPHQWHULQJ WKHEXLOGLQJ3HUIRUPDQFHRIWKHVHUHSDLUVDFWLRQVE\WKH2ZQHUGRHVQRWLQGLFDWHDFFHSWDQFHRI WKHFRQGLWLRQDQGGRHVQRWDEVROYHWKH&RQWUDFWRUIURPWKHUHVSRQVLELOLW\RISURPSWSHUPDQHQW UHSDLUVDQGUHSODFHPHQW UHSDLURUUHLPEXUVHPHQWIRUGDPDJHGLQWHULRUILQLVKHVIHDWXUHV7KH FRQWUDFWRUZLOOPDNHSHUPDQHQWUHSDLUVZLWKQRFRVWWRWKH2ZQHU ' ,IZDWHUHQWU\LQWRWKHURRIV\VWHPRFFXUVWKHDIIHFWHGPDWHULDOVVKDOOEHUHPRYHGEDFNWRGU\VRXQG PDWHULDOVDQGUHSODFHGZLWKQHZPDWHULDOVDWWKH&RQWUDFWRU¶VH[SHQVH ( ,IZDWHUHQWU\LQWRWKHEXLOGLQJRFFXUVWKH&RQWUDFWRUPXVWSURPSWO\UHYLHZDQGDJUHHXSRQWKH GDPDJHVZLWKWKH2ZQHU¶VUHSUHVHQWDWLYH5HSDLUVWRWKHLQWHULRUILQLVKHVPXVWEHFRPSOHWHG SURPSWO\ZLWKLQDVFKHGXOHGWLPHIUDPHDJUHHGXSRQE\WKH2ZQHU5HSODFHPHQWUHSDLURU UHLPEXUVHPHQW IRU GDPDJHG LQWHULRU PDWHULDOV HTXLSPHQW ERRNV IXUQLWXUH HWF PXVW EH FRPSOHWHGSURPSWO\ZLWKLQDVFKHGXOHGWLPHIUDPHDJUHHGXSRQE\WKH2ZQHU,IWKHWLPHOLQH SURYLGHGE\WKH&RQWUDFWRULVQRWVDWLVIDFWRU\WRWKH2ZQHUDQGDQDJUHHPHQWFDQQRWEHSURPSWO\ UHDFKHGWKH2ZQHUUHVHUYHVWKHULJKWWRSHUIRUPVXFKUHSDLUVRUUHSODFHPHQWVDQGVKDOOGHGXFWWKH FRVWRIUHSDLUVIURPWKH&RQWUDFW6XP ) 7KH&RQWUDFWRUPD\DWKLVRSWLRQSURYLGHDIWHUKRXUVSURWHFWLRQRILQWHULRUPDWHULDOVFRPSXWHUV ERRNVHWFDWDUHDVRIVSHFLILFFRQFHUQRUOLDELOLW\,QVWDOODWLRQRISURWHFWLRQVXFKDVSODVWLFVKHHWV HWFVKDOOEHSHUIRUPHGE\WKH&RQWUDFWRU¶VSHUVRQQHOZLWKWKHDGYDQFHDSSURYDORI)DFLOLWLHV 0DQDJHPHQW,QVWDOODWLRQVVKDOOQRWGDPDJHSHUPDQHQWPDWHULDOVRUILQLVKHV&RQWUDFWRUVKDOOEH UHVSRQVLEOHIRUUHPRYDORIWKHWHPSRUDU\SURWHFWLRQIRUQRUPDOXVHRIWKHLQWHULRUFRQWHQWVGXULQJ VWDQGDUGEXLOGLQJKRXUV -2%&203/(7,21 $ ,QVSHFWFRPSOHWHGURRILQJDQGFRUUHFWGHIHFWVWRPHHWWKHVSHFLILFDWLRQUHTXLUHPHQWV % 5RRIV\VWHPPDQXIDFWXUHU¶VUHSUHVHQWDWLYHVKDOOLQVSHFWWKHFRPSOHWHGURRILQJV\VWHPDQGQRWLI\ WKH&RQWUDFWRURIDQ\GHIHFWVLQWKHDSSOLFDWLRQ & &OHDQXSGHEULVH[FHVVPDWHULDOVDQGHTXLSPHQWDQGUHPRYHIURPVLWH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±7+(5023/$67,&6,1*/(3/<522)6<67(0 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ' &OHDQGULSVRUVSLOOVRIDGKHVLYHRUSULPHUV3URYLGHDQRYHUDOOVXUIDFHFOHDQLQJRIWKHURRI PHPEUDQHDQGIODVKLQJVXVLQJGHWHUJHQWVRUFOHDQHUVDVDSSURYHGUHFRPPHQGHGE\WKHURRIV\VWHP PDQXIDFWXUHU (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 6+((70(7$/)/$6+,1*$1'75,0 3$57 *(1(5$/ :25.,1&/8'(' $ 3URYLGHDOOODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRUIDEULFDWLRQDQGLQVWDOODWLRQRI PHWDOIODVKLQJFRSLQJDVVHPEOLHVFRXQWHUIODVKLQJVWULPDQGDFFHVVRULHVDVVSHFLILHGKHUHLQDQGDV UHTXLUHGE\GHWDLOGUDZLQJV % &RRUGLQDWHZRUNRIWKLVVHFWLRQZLWKZRUNRI6HFWLRQVDQG 48$/,7<$6685$1&( $ 4XDOLILFDWLRQVRI0DQXIDFWXUHU3URGXFWVXVHGLQWKHZRUNRIWKLVVHFWLRQVKDOOEHSURGXFHGE\ PDQXIDFWXUHUV UHJXODUO\ HQJDJHG LQ WKH PDQXIDFWXUH RI VLPLODU LWHPV DQG ZLWK D KLVWRU\ RI VXFFHVVIXOSURGXFWLRQDFFHSWDEOHWRWKH2ZQHU % 4XDOLILFDWLRQVRI&RQWUDFWRU8VHDGHTXDWHQXPEHURIVNLOOHGZRUNPHQZKRDUHWKRURXJKO\WUDLQHG DQGH[SHULHQFHGLQWKHQHFHVVDU\FUDIWVDQGDUHFRPSOHWHO\IDPLOLDUZLWKWKHVSHFLILHGUHTXLUHPHQWV DQGWKHPHWKRGVQHHGHGIRUWKHSURSHUSHUIRUPDQFHRIWKHZRUNLQWKLVVHFWLRQ,QDFFHSWDQFHRU UHMHFWLRQRIWKHZRUNRIWKLVVHFWLRQWKH2ZQHUVKDOOPDNHQRDOORZDQFHIRUODFNRIVNLOORQWKH SDUWRIWKHZRUNPHQ & &RPSO\ZLWKSHUWLQHQWFRGHVDQGUHJXODWLRQVLQFOXGLQJUHFRPPHQGDWLRQVFRQWDLQHGLQWKHPRVWUHFHQW HGLWLRQRIWKH$UFKLWHFWXUDO6KHHW0HWDO0DQXDOSXEOLVKHGE\WKH6KHHW0HWDODQG$LU&RQGLWLRQLQJ &RQWUDFWRUV1DWLRQDO$VVRFLDWLRQ60$&1$ ' :KHQVKHHWPHWDOIODVKLQJIRUPDQLQWHJUDOSDUWRIWKHZHDWKHUWLJKWQHVVRIDGHWDLOFRPSO\ZLWKURRI V\VWHPPDQXIDFWXUHUUHTXLUHPHQWV:KHUHPDQXIDFWXUHUUHFRPPHQGDWLRQVGLIIHUIURP60$&1$RU WKHGHVLJQVSHFLILFDWLRQVDQGGUDZLQJVWKHPRUHVWULQJHQWUHTXLUHPHQWZLOOWDNHSUHFHGHQFHXQOHVV RWKHUZLVHDJUHHGXSRQZLWKWKH(QJLQHHU 68%0,77$/6 $ 6XEPLWSURGXFWGDWDLQVWDOODWLRQLQVWUXFWLRQVVDPSOHZDUUDQWLHVDQG6'6VKHHWVIRUVKHHWPHWDO FRPSRQHQWVWREHLQVWDOOHG % 6XEPLWFRORUVDPSOHFKDUWIRUSUHILQLVKHGPDWHULDOV&RORUVDPSOHFKLSVPD\EHUHTXHVWHGWRDLG LQILQDOVHOHFWLRQRIFRORUV & 6XEPLWVKRSGUDZLQJVFOHDUO\GHWDLOLQJVKDSLQJMRLQWLQJOHQJWKRIVHFWLRQVIDVWHQHUW\SHDQG VSDFLQJJDXJHRIPDWHULDOVDQGLQVWDOODWLRQGHWDLOV7KLVLQIRUPDWLRQPD\EHLQFRUSRUDWHGLQWRWKH RYHUDOOURRIV\VWHPVKRSGUDZLQJV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW '(/,9(5<6725$*($1'+$1'/,1* $ 'HOLYHUVKHHWPHWDOPDWHULDOVDQGDFFHVVRULHVZLWKRULJLQDOSURWHFWLYHZUDSRUER[LQJZLWKODEHOVLQWDFW DQGOHJLEOH&RPSO\ZLWKPDQXIDFWXUHU VSXEOLVKHGLQVWUXFWLRQVIRUVWRUDJHDQGKDQGOLQJ % 6WRUHPDWHULDOVLQGU\SURWHFWHGDUHDVRQFOHDQUDLVHGSODWIRUPVZLWKVHFXUHO\DQFKRUHGZHDWKHU SURWHFWLYHFRYHULQJVDQGLQVXFKPDQQHUDVWRSUHYHQWFRQGHQVDWLRQRUVWDLQLQJ6WDFNPDWHULDOWR SUHYHQWWZLVWLQJEHQGLQJRUDEUDVLRQ & 'XULQJVWRUDJHSUHYHQWPDWHULDOFRQWDFWZLWKDQ\VXEVWDQFHWKDWZRXOGGLVFRORURUVWDLQLQFOXGLQJVRLO DQGZDWHU 6&+('8/,1* $ 7KH&RQWUDFWRUVKDOOILHOGYHULI\H[LVWLQJFRQGLWLRQVSULRUWRIDEULFDWLRQRIVKHHWPHWDOFRPSRQHQWV 0LQRUGLPHQVLRQDOGHWDLOFKDQJHVPD\EHUHTXLUHGWRILWH[LVWLQJFRQGLWLRQV)LHOGYHULILFDWLRQPXVW EHSHUIRUPHGZLWKHQRXJKWLPHWRPDNHUHYLVLRQVWRVKRSGUDZLQJVDQGWRDOORZIRUSURSHUIDEULFDWLRQ RIFRPSRQHQWVZLWKRXWSURMHFWGHOD\ % 6KHHWPHWDOZRUNVKDOOEHFORVHO\FRRUGLQDWHGZLWKWKHLQVWDOODWLRQRIQHZURRILQJPDWHULDOV & 6KHHWPHWDOLQVWDOODWLRQVVKDOOEHVFKHGXOHGVXFKWKDWURRILQJWHUPLQDWLRQVZLOOQRWEHOHIWXQSURWHFWHG :$55$17,(6 $ 3URYLGHD&RQWUDFWRU¶V)LYH<HDU:DUUDQW\IRUZRUNLQFOXGHGLQWKLVSURMHFWLQDFFRUGDQFHZLWK 6HFWLRQRIWKHVHVSHFLILFDWLRQV % 3UHILQLVKHGVKHHWPHWDOVKDOOKDYHD\HDUILQLVKZDUUDQW\VWDWLQJWKDWWKHSUHILQLVKZLOOEHIUHHRI IDGLQJRUFRORUFKDQJHLQH[FHVVRI1%6XQLWVLQDFFRUGDQFHZLWK$670'ZLOOQRWFKDONLQ H[FHVVRIQXPHULFDOUDWLQJRILQDFFRUGDQFHZLWK$670'DQGZLOOQRWSHHOFUDFNFKLSRU GHODPLQDWH 3$57 352'8&76 6+((70(7$/0$7(5,$/6 $3UH)LQLVKHG6KHHW0HWDO(GJHPHWDOFRYHUSODWHVFRSLQJIDFHSODWHVFRQGXFWRUKHDGVGRZQVSRXWV DQGPLVFWULP3URYLGHƎWKLFNDOXPLQXPIODVKLQJVPHHWLQJ$670%SUHILQLVKHGLQ DFFRUGDQFHZLWKDWZRFRDWFRLODSSOLHGEDNHGRQIOXRURSRO\PHUFRDWLQJV\VWHPEDVHGRQ.\QDU )OXRURFDUERQFRDWLQJZLWKDWRSVLGHWRWDOGU\ILOPWKLFNQHVVRIPLOERWWRPVLGHVKDOOEH FRDWHGZLWKDSULPHUZLWKDGU\ILOPWKLFNQHVVRIPLO)LQLVKVKDOOFRQIRUPWRDOOWHVWVIRU DGKHVLRQIOH[LELOLW\IDGLQJFKDONLQJSHHOUHVLVWDQFHDQGORQJHYLW\LQDFFRUGDQFHZLWK$670' DQG$670'7KH2ZQHUUHVHUYHVWKHULJKWWRVHOHFWDPLOOILQLVKHGDOXPLQXPLQOLHXRID SUHILQLVKHGFRORUIRUWKHVHFRPSRQHQWV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW %0HPEUDQH&ODG 0HWDO 3URYLGH Ǝ WKLFN DOXPLQXP VXEVWUDWH FRDWHGODPLQDWHG ZLWK WKH PHPEUDQHPDQXIDFWXUHU¶VDSSURYHGPHPEUDQHPDWHULDOPLOPLQLPXPWKLFNQHVV&RORUWREH VHOHFWHGIURPWKHPHPEUDQHPDQXIDFWXUHU¶VVWDQGDUGFRORUV3URGXFWVKDOOEHPDQXIDFWXUHGE\WKH ORZVORSHGVLQJOHSO\WKHUPRSODVWLFPHPEUDQHPDQXIDFWXUHUDQGFRPSDWLEOHIRUKRWDLUZHOGLQJWR URRIV\VWHPPHPEUDQHDQGIODVKLQJPDWHULDOV&RORURIFODGPHWDOPXVWPDWFKFRORURIPHPEUDQHDQG IODVKLQJV & &RXQWHUIODVKLQJUDLQVKLHOGDQGRWKHUQRWHGWULP6KDOOEH7\SHVWDLQOHVVVWHHO*$XQOHVV RWKHUZLVH QRWHG RQ GHWDLOV FROG UROOHG DQQHDOHG ZLWK D % ILQLVK DQG FRQIRUPLQJ WR WKH UHTXLUHPHQWVRI$670$ ' &OHDWPLODOXPLQXPRUJDXJHVWDLQOHVVVWHHOZLWKSURILOHDVVKRZQRQWKHGUDZLQJV)RUDQ\ RWKHUFOHDWVSURYLGHPDWHULDOWRPDWFKDVVRFLDWHGIODVKLQJRQHJDXJHODUJHUKHDYLHUWKDQWKHPDWHULDO EHLQJFOHDWHGXQOHVVRWKHUZLVHQRWHG ( 7HUPLQDWLRQEDU8VHRQO\PHPEUDQHPDQXIDFWXUHUVXSSOLHGDOXPLQXPRUVWDLQOHVVVWHHOWHUPLQDWLRQ DFFHVVRULHVƎ[Ǝ%DUVKDOOKDYHSUHGULOOHGVORWWHGKROHVDWƎRF1RSODVWLFRUSRO\PHU WHUPLQDWLRQEDUVZLOOEHDFFHSWHG ) 732 0DWHULDOV 732 &RDWHG0HWDO HWF 9HULI\ PDQXIDFWXUHUZLWKWKH2ZQHUDQGXVHWKDW PDQXIDFWXUHU¶VPDWHULDOV7KHURRILVXQGHUZDUUDQW\VRLQVWDOODWLRQRIWKHGHWDLOVZLOOQHHGWREH SHUIRUPHGE\DFHUWLILHGFRQWUDFWRU )$67(1(56$1'$&&(6625,(6 $0HWDOWRPHWDO IDVWHQHUV :KHUH QRW VSHFLILFDOO\ SURYLGHG DV DSDUWRIDSUHIDEULFDWHG DVVHPEO\V\VWHPSURYLGHVHOIWDSSLQJVHOIGULOOLQJQRVKHHWPHWDOVFUHZV8VHVWDLQOHVVVWHHO IDVWHQHUV3URYLGH(3'0ZDVKHUVZLWKH[SRVHGIDVWHQHUVDQGFRDWIDVWHQHUVWRPDWFKFRORURIDGMDFHQW PHWDOIODVKLQJ)DVWHQHUVSDFLQJPD[LPXPRFXQOHVVRWKHUZLVHQRWHGRQGUDZLQJV %0HWDOWRZRRG1RVWDLQOHVVVWHHOZRRGVFUHZVZKHUHQRWH[SRVHG0LQLPXPHPEHGPHQWVKDOO EHƎ:KHUHH[SRVHGVFUHZVPXVWEHVWDLQOHVVVWHHODQGKDYHDQ(3'0ZDVKHU)DVWHQHU VSDFLQJPD[LPXPRFXQOHVVRWKHUZLVHQRWHGRQGUDZLQJV &0HWDOWRPDVRQU\RUFRQFUHWH8VHGLDPHWHUVWDLQOHVVVWHHOPDVRQU\DQFKRUV5DZO³7DSFRQ´RU DSSURYHGVXEVWLWXWHZKHUHQRWH[SRVHG'ULYHSLQRUSRZGHUDFWXDWHGIDVWHQHUVPXVWEHDSSURYHGE\ WKH'HVLJQHUWRDOORZIRUFRQVLGHUDWLRQRISRWHQWLDOGDPDJHWRVXEVWUDWHV0LQLPXPHPEHGPHQWVKDOO EH:KHUHH[SRVHGIDVWHQHUVPXVWEHVWDLQOHVVVWHHODQGKDYH(3'0ZDVKHUV([SRVHGIDVWHQHUV PXVWEHFRDWHGWRPDWFKFRORURIDGMDFHQWPHWDOIODVKLQJ)DVWHQHUVSDFLQJPD[LPXPRQFHQWHU XQOHVVRWKHUZLVHQRWHGRQGUDZLQJV '3RS5LYHWV6WDLQOHVV6WHHO6KDOOEHPLQLPXPGLDPHWHUZLWKVWDLQOHVVVWHHOPDQGUHOVDQG ZDVKHUV:KHUHH[SRVHGSUHILQLVKULYHWVWRPDWFKDGMDFHQWIODVKLQJPDWHULDO (3LSH&ODPSV6KDOOEHVWDLQOHVVVWHHO DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW )6HDODQW)RUVHDODQWLQFRQWDFWZLWKPHWDOSURYLGHJXQJUDGHEXW\OFRQFHDOHGRUSRO\XUHWKDQH EDVHGVHDODQWVH[SRVHGFRORUVWREHVHOHFWHGEDVHGRQORFDWLRQRIXVH *6WDLQOHVVVWHHO*XWWHUVXSSRUW6KDOOEHJDXJHVWDLQOHVVVWHHO +3URYLGHRWKHUIODVKLQJFRPSRQHQWVDQGIDVWHQHUVQRWVSHFLILFDOO\GHVFULEHGEXWUHTXLUHGIRUDFRPSOHWH DQGSURSHULQVWDOODWLRQRIWKHZRUNDQGVXEMHFWWRWKHDSSURYDORIWKH(QJLQHHUDQGRUWKH2ZQHU¶V UHSUHVHQWDWLYH 3$57 (;(&87,21 685)$&(&21',7,216$1'35(3$5$7,21 $ ([DPLQHWKHDUHDVDQGFRQGLWLRQVXQGHUZKLFKZRUNRIWKLVVHFWLRQZLOOEHSHUIRUPHG&RUUHFW FRQGLWLRQVGHWULPHQWDOWRWLPHO\DQGSURSHUFRPSOHWLRQRI:RUN,QVSHFWQDLOHUDUHDVWRYHULI\WKDW WKH\DUHFOHDQVPRRWKIUHHRIGHSUHVVLRQVZDYHVRUSURMHFWLRQVDQGVROLGO\VXSSRUWHGRYHUMRLQWV % 5HPRYHH[LVWLQJVXEVWUDWHVDVUHTXLUHGIRUSURSHUIODVKLQJLQVWDOODWLRQ & %HJLQQLQJLQVWDOODWLRQVKDOOFRQVWLWXWHDFFHSWDQFHRIWKHH[LVWLQJFRQGLWLRQVE\&RQWUDFWRU ' &RQILUPFRPSOHWHLQVWDOODWLRQRIZRRGEORFNLQJLQVXODWLRQSO\ZRRGDQGIODVKLQJPHPEUDQHGHWDLOV SULRUWRWKHVWDUWRIPHWDOIODVKLQJLQVWDOODWLRQ )$%5,&$7,21 $ *HQHUDO)DEULFDWHVKHHWPHWDOFRSLQJVDQGIODVKLQJVWRFRPSO\ZLWKGHVLJQGHWDLOVVKRZQDQG JHQHUDOUHFRPPHQGDWLRQVDVSURYLGHGLQWKHODWHVWHGLWLRQVRI60$&1$ % )LHOGYHULW\VLWHFRQGLWLRQVSULRUWRIDEULFDWLQJZRUN & )RUPIODVKLQJVWRSURYLGHZHDWKHUWLJKWRUZDWHUWLJKWLQVWDOODWLRQVDVVSHFLILHG$OORZIRUSURSHU H[SDQVLRQDQGFRQWUDFWLRQ1RH[SRVHGIDVWHQHUVZLOOEHDOORZHGXQOHVVVSHFLILFDOO\VKRZQRQWKH GHWDLOGUDZLQJV ' &RQILUPFRPSDWLELOLW\RIIODVKLQJPDWHULDOVZLWKWKRVHWKDWZLOOEHIODVKHGDQGLQGLUHFWFRQWDFW ZLWKVXFKPDWHULDOV3UHYHQWFRQWDFWEHWZHHQGLVVLPLODUPHWDOVWRSUHYHQWJDOYDQLFDFWLRQ,I FRQWDFWFDQQRWEHDYRLGHGXVHSUHYHQWLYHPHDVXUHVWRSURYLGHDGHTXDWHVHSDUDWLRQ ( )RUPIODVKLQJVWRSURILOHVVKRZQRQDSSURYHGVKRSGUDZLQJGHWDLOV)RUPVHFWLRQVVTXDUHWUXHDQG DFFXUDWHWRVL]HIUHHIURPGLVWRUWLRQDQGRWKHUGHIHFWVGHWULPHQWDOWRDSSHDUDQFHDQGSHUIRUPDQFH ) )RUPVHFWLRQVLQPD[LPXPWHQIRRWOHQJWKV+HPH[SRVHGHGJHVRIIODVKLQJVRQXQGHUVLGH )DEULFDWHFRUQHUVVRWKDWMRLQWVQHDUURRISHULPHWHUFRUQHUVDUHDWOHDVWDZD\IURPFRUQHU * $WORFDWLRQVZKHUHQHZVKHHWPHWDOVHFWLRQVDEXWZDOOVRUWHUPLQDWHWKHPHWDOIODVKLQJVKDOOEH IDEULFDWHGWRWHUPLQDWHZLWKHQGVHFWLRQVRIRQHSLHFHFRQVWUXFWLRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW + &ULPSPHWDODVQHFHVVDU\WRSUHYHQWPHWDOIURPWRXFKLQJPHPEUDQH'RQRWVFUDWFKILQLVK ,163(&7,21$1'685)$&(35(3$5$7,21 $ ,QVSHFWSDUDSHWZDOOVSHULPHWHUEORFNLQJFXUEHGXQLWVDQGRWKHUSHQHWUDWLRQVVXUIDFHVWRUHFHLYH IODVKLQJFRSLQJRUWULPWRHQVXUHFRPSOHWHLQVWDOODWLRQSURSHUVHFXUHPHQWDQGWKDWWKH\DUHIUHH RIORRVHGHEULVDQGH[FHVVVHDODQW % &RQILUPWKDWSURSHULQVWDOODWLRQRIURRIV\VWHPFRPSRQHQWVLQDFFRUGDQFHZLWK6HFWLRQ KDYHEHHQFRPSOHWHGSULRUWRLQVWDOODWLRQRIPHWDOIODVKLQJV & 3URFHHGZLWKLQVWDOODWLRQRQO\DIWHUXQVDWLVIDFWRU\FRQGLWLRQVKDYHEHHQFRUUHFWHG ('*(0(7$/ $ /HDYHDƎJDSEHWZHHQHGJHPHWDO&RYHUJDSZLWKFRYHUSODWHDWMRLQWVDVUHFRPPHQGHGLQWKH PRVWUHFHQWHGLWLRQRI60$&1$GXHWRFRSLQJZLGWK,QVWDOODPLQLPXPRIZLGHFRYHUSODWHV ,QVWDOOWZRURZVRIVHDODQWRQERWKVLGHVRIWKHJDS1DLOWKHFRYHUSODWHWRWKHQDLOHUWKURXJKWKH JDSLQWKHPHWDO % 6HFXUHIODQJHVRIHGJHPHWDOZLWKDSSURSULDWHIDVWHQHUDWƎRF)DVWHQHUVVKDOOEHVWDJJHUHGLQ WZRURZVZLWKWKHILUVWURESRVLWLRQHGƎIURPWKHOHDGLQJHGJHRIWKHIODQJHWKHVHFRQGURZVKDOO EHSRVLWLRQHGƎIURPWKHILUVWURZ & )RUPDFRQWLQXRXVFOHDWDWWKHRXWVLGHRIWKHZDOOWRSURYLGHDQHYHQHGJH)DFHVHFXUHWKHVXSSRUW FOHDWDWƎRFZLWKLQIHHWRIWKHFRUQHUDQGRQFHQWHUHOVHZKHUH&OHDWMRLQWVVKDOOFRLQFLGH ZLWKZDOOH[SDQVLRQMRLQWV ' ,QVWDOOPHPEUDQHRYHUWRSRYHUHGJHWRFRYHUFRQWLQXRXVFOHDWDQGQDLOVDVVKRZQRQWKHGUDZLQJV ( &ULPSDORQJFOHDWDWDPLQLPXPRIRF&ULPSVRWKDWPHWDOLVQRWWRXFKLQJWKHPHPEUDQH IODVKLQJ &2817(5)/$6+,1*,167$//$7,21 $ )RUUHJOHWPRXQWHGFRXQWHUIODVKLQJFXWUHJOHWLQWKHH[LVWLQJPDVRQU\ZDOODWORFDWLRQVVKRZQRQ WKHGUDZLQJV,QVWDOOOHDGZHGJHVDWRQFHQWHUWRVHFXUHFRXQWHUIODVKLQJ,QVWDOOVHDODQW DORQJWKHWRSRIWKHFRXQWHUIODVKLQJ % )RUFRXQWHUIODVKLQJWREHVHFXUHGWRH[LVWLQJWKURXJKZDOOIDVWHQLQDFFRUGDQFHZLWKWKHGHWDLO GUDZLQJV & 7KHERWWRPRIWKHFRXQWHUIODVKLQJVKDOOH[WHQGEHORZWKHDGMDFHQWPHPEUDQHWHUPLQDWLRQEDUD PLQLPXPRIEXWVKDOOLQQRFDVHWRXFKWKHVXUIDFHRIWKHURRIPHPEUDQH,IYHUWLFDOIODVKLQJ WHUPLQDWHVH[WHQGFRXQWHUIODVKLQJDORQJZDOORUDURXQGFRUQHUVDVQHHGHGWRSURSHUO\FRYHU WHUPLQDWLRQIODVKLQJVXQOHVVRWKHUZLVHDJUHHGXSRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW ' 6HFXUHFRXQWHUIODVKLQJVWRH[LVWLQJWKURXJKZDOOIODVKLQJUHFHLYHUVH[LVWLQJFXUEHGXQLWFDSVQHZ FXWUHJOHWVRUDWRWKHUORFDWLRQVDVVKRZQRQWKHGUDZLQJV ( /DSFRXQWHUIODVKLQJMRLQWVDPLQLPXPRIVWDJJHUMRLQWVLQFODPSLQJWHUPLQDWLRQEDUIURP FRXQWHUIODVKLQJMRLQWE\¶PLQLPXP ) $SSO\VHDODQWEHWZHHQIODWVXUIDFHRIFRXQWHUIODVKLQJDQGUHFHLYHUVZDOOVFXUEVHWFSULRUWR VHFXULQJ * 3URYLGHPHWDOFORVXUHVDWHQGVRIFRXQWHUIODVKLQJ0LWHUODSFRUQHUVVRWKDWFRXQWHUIODVKLQJPHHWV DGMDFHQWDORQJWKHHQWLUHSURILOHDQGHGJHHQGLVQRWVSOLW 35,0$5<$1'29(5)/2:6&833(56 $9HULI\VFXSSHUORFDWLRQVZLWK'HVLJQHUDQGSULRUWRSODFHPHQWRIRSHQLQJVLQQHZSHULPHWHU EORFNLQJSO\ZRRG %&XWQHZRYHUIORZVFXSSHURSHQLQJDWORFDWLRQVKRZQRQWKHURRISODQ2YHUIORZVFXSSHUVKDOOEH DPD[LPXPRI´DERYHWKHILQLVKHGURRIVXUIDFH &,QVWDOOVFXSSHUIODVKLQJVOHHYHVLQWRDVHDODQWEHGLQWKHQHZZDOORSHQLQJWRILOOYRLGEHWZHHQZDOO RSHQLQJDQGIODVKLQJ)DVWHQVFXSSHUIODVKLQJWRLQVLGHIDFHRIZDOODWIODQJHDQGLQVWDOODGGLWLRQDO VHDODQWEHWZHHQIODQJHDQGZDOODWRXWVLGHIDFH '$WWKHRXWHUIDFHRIWKHVFXSSHULQVWDOODSUHILQLVKHGIDFHSODWHWRFRYHUWKHFODGPHWDOIODQJH)DVWHQ WKHIDFHSODWHLQDFFRUGDQFHZLWKWKHGUDZLQJVWRSURYLGHDQHYHQO\VSDFHGDSSHDUDQFH &/($183 $ ([FHVVVHDODQWDGKHVLYHVDQGRURWKHUPDWHULDOVPXVWEHFOHDQHGIURPWKHVKHHWPHWDOVXUIDFHV % $OOKDQGSULQWVVPXGJHVDQGRWKHUVXSHUILFLDOVWDLQVWKDWZHUHSODFHGRQWKHVKHHWPHWDOGXULQJ IDEULFDWLRQDQGLQVWDOODWLRQVKDOOEHUHPRYHG & $OOIDFWRU\DSSOLHGSURWHFWLYHSODVWLFILOPVVKDOOEHUHPRYHG ' $OODEUDVLRQVVFUDWFKHVVFUDSHVHWFVKDOOEHWRXFKHGXSZLWKSDLQWIXUQLVKHGE\WKHVKHHWPHWDO PDQXIDFWXUHU ( 5HPRYHDOOWULPPLQJVIDVWHQHUVDQGGHEULVDQGGLVSRVHGDLO\7ULPPLQJVDQGVKDUSSLHFHVVKDOO QRWEHDOORZHGWRDFFXPXODWHRQWKHURRI ),(/'48$/,7<&21752/ $ 7KH&RQWUDFWRULVUHVSRQVLEOHIRULQLWLDWLQJDQGPDLQWDLQLQJGDLO\H[HFXWLRQRIDTXDOLW\FRQWURO SURJUDPWKDWZLOOLQFOXGHEXWLVQRWOLPLWHGWRVXSHUYLVLRQE\WKHMREIRUHPDQRUVXSHUYLVRUGXULQJ VXEVWUDWH SUHSDUDWLRQ LQVWDOODWLRQ RI VKHHW PHWDO FRPSRQHQWVDYRLGDQFH RI RLO FDQQLQJ DQG LUUHJXODULWLHVLQWKHPHWDOILQLVKSURSHUPHWDOWHUPLQDWLRQDQGVHFXUHPHQW DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)/$6+,1*$1'6+((70(7$/ 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW % 'RQRWLQVWDOORUIRUFHILWPHWDOIODVKLQJFRPSRQHQWVWKDWGRQRWILWSURSHUO\GXHWRHUURUVGXULQJ ILHOGPHDVXUHPHQWDQGIDEULFDWLRQ2LOFDQQLQJRIVKHHWPHWDOVXUIDFHVGXHWRIDEULFDWLRQDQGRU LQVWDOODWLRQPD\EHFRQVLGHUHGFDXVHIRUUHMHFWLRQ & &RUUHFWGHIHFWVDQGLUUHJXODULWLHVREVHUYHGE\(QJLQHHURU2ZQHU¶VUHSUHVHQWDWLYH ' &RQWUDFWRUVKDOOSODQVHTXHQFHRIZRUNWRSUHYHQWGDPDJHVWRWKHVKHHWPHWDOLQVWDOODWLRQV3URWHFW SUHILQLVKHGIODVKLQJVIURPH[SRVXUHWRPRUWDUFRQFUHWHDQGRWKHUFHPHQWLWLRXVPDWHULDOV ( $EUDVLRQVVFUDWFKHVVFUDSHVHWFLQSUHILQLVKHGPHWDOVVKDOOEHWRXFKHGXSZLWKSDLQWIXUQLVKHG E\WKHVKHHWPHWDOPDQXIDFWXUHU3K\VLFDOGDPDJHWRIODVKLQJVPD\UHVXOWLQUHMHFWLRQE\WKH 'HVLJQHUDQGUHTXLUHUHPRYDODQGUHSODFHPHQW0LQRUGDPDJHWKDWLVDFFHSWHGE\WKH'HVLJQHU PXVWEHWRXFKHGXSWRSUHYHQWSRWHQWLDOFRUURVLRQDWGDPDJHGSUHILQLVKFRDW7RXFKXSSDLQW DFWLYLWLHVPXVWEHFRRUGLQDWHGZLWKWKH'HVLJQHUWRDOORZIRUGLUHFWLRQE\'HVLJQHUDQG2ZQHUSULRU WRSURFHHGLQJ -2%$1':($7+(5&21',7,216 $ 6XVSHQGDOODSSOLFDWLRQDQGLQVWDOODWLRQDFWLYLWLHVGXULQJLQFOHPHQWZHDWKHU % 3URWHFWDGMDFHQWEXLOGLQJVXUIDFHVDJDLQVWGDPDJH & 5HPRYHGHEULVIURPURRIDQGVLWHRQDGDLO\EDVLVDQGGLVSRVHDWDQDSSURYHGGLVSRVDOVLWH ' 'RQRWSHUPLWWUDIILFRYHUFRPSOHWHGURRIVXUIDFHV (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)$&&(6625,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 522)$&&(6625,(6 3$57 *(1(5$/ :25.,1&/8'(' $ 3URYLGHDOOODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRUWKHGHVLJQIDEULFDWLRQDQG LQVWDOODWLRQRIQHZURRIKDWFKUDLODQGLQVWDOODWLRQRIDQRQSHQHWUDWLQJUDLOLQJDQGRWKHUDFFHVVRULHV DVVSHFLILHGKHUHLQDQGDVUHTXLUHGWRSURYLGHSURSHUO\IXQFWLRQLQJDQGZDWHUWLJKWGHWDLOVDVVKRZQ RQWKHGUDZLQJVDQGVSHFLILHGLQWKLVVHFWLRQ 48$/,7<$6685$1&( $ 8VHDGHTXDWHQXPEHUVRIVNLOOHGZRUNPHQZKRDUHWKRURXJKO\WUDLQHGDQGH[SHULHQFHGLQWKH QHFHVVDU\FUDIWVDQGZKRDUHFRPSOHWHO\IDPLOLDUZLWKWKHVSHFLILHGUHTXLUHPHQWVDQGWKHPHWKRGV QHHGHGIRUSURSHUSHUIRUPDQFHRIWKHZRUNLQWKLVVHFWLRQ 68%0,77$/6 $5RRI+DWFK&RPSRQHQWV 6XEPLWSURGXFWGDWDPDWHULDOGHVFULSWLRQVGLPHQVLRQVSURILOHVDQGILQLVKHVRIKDWFK FRPSRQHQWV 6XEPLWKDWFKZDUUDQW\LQIRUPDWLRQ 3URYLGHVKRSGUDZLQJVFRRUGLQDWLQJORFDWLRQRIFRPSRQHQWV7KH&RQWUDFWRUVKDOOYHULI\ H[LVWLQJILHOGFRQGLWLRQV %2WKHU&RPSRQHQWV 3URYLGHSURGXFWGDWDIRUQRQSHQHWUDWLQJUDLOLQJDQGDQ\RWKHUDFFHVVRULHVQRWOLVWHGEXW UHTXLUHGIRUSURSHULQVWDOODWLRQRIWKHZRUN '(/,9(5<6725$*($1'+$1'/,1* $ +DQGOH DQG VWRUH SURGXFWV LQ WKH PDQXIDFWXUHU¶V XQRSHQHG SDFNDJLQJ XQWLO UHDG\ IRU LQVWDOODWLRQ)ROORZWKHPDQXIDFWXUHU¶VUHTXLUHPHQWVUHJDUGLQJDQ\VWRUDJHH[SRVXUHOLPLWV VXFKDVWHPSHUDWXUHRUKXPLGLW\UDQJHVRUYHQWLODWLRQFRQGLWLRQVWRSUHYHQWGDPDJHWR FRPSRQHQWVDQGPDWHULDOV % 6WRUDJHDQGKDQGOLQJVKDOOQRWSURWHFWWKHFRPSRQHQWILQLVKHV&RQILUPWKDWFRQGLWLRQRI FRPSRQHQWVDQGILQLVKHVDUHXQGDPDJHGSULRUWRLQSODFHLQVWDOODWLRQRIWKHPDWHULDOV 6&+('8/,1* $7KH&RQWUDFWRUVKDOOFRRUGLQDWHZLWKURRILQJLQVWDOODWLRQWRHQVXUHWKDWURRIKDWFKUDLOLQJ PDWHULDOLVSUHVHQWRQVLWHDQGUHDG\IRULQVWDOODWLRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)$&&(6625,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 3$57 352'8&76 $ 5RRI+DWFK6DIHW\5DLO6KDOOEHFRQVWUXFWHGIURPDJDOYDQL]HGVWHHOIUDPHDQGILQLVK̶DERYH URRI0HHW26+$DQGVWDQGDUGV7KHVDIHW\UDLOVKRXOGKDYHDVHOIFORVLQJJDWH JUDEEDUVDQGQRWSHQHWUDWHWKHFXUE6LPLODUWRURRIKDWFKVDIHW\UDLOVROGE\$0H]],QGXVWULDO 6WUXFWXUHVZZZDPH]]FRP % *XDUGUDLO1RQSHQHWUDWLQJ6KDOOEHSUHIDEULFDWHGQRQSHQHWUDWLQJJXDUGUDLOZLWKPRYDEOHZHLJKWHG EDVHVLQFOXGHGDVDIDOOSRVLWLRQLQJV\VWHPWKDWKDVDWRSDQGPLGUDLOWRPHHW26+$&)5 DQG&)55DLOLQJPXVWDOVRPHHWFXUUHQW1&6%&UHTXLUHPHQWV5DLOVVKDOOEHD PLQLPXP´GLDPHWHUJDOYDQL]HGSLSH7KHJXDUGUDLOVKDOOEHDPLQLPXPRI´DERYHWKHILQLVKHG URRIV\VWHP3URYLGHDOODFFHVVRULHVWRFRPSOHWHLQVWDOODWLRQPRXQWLQJEDVHVUHFHLYHUSRVWKDUGZDUH HWF6LPLODUWRV\VWHPSURYLGHGE\%OXHZDWHU0DQXIDFWXULQJ,QVWDOOZDONWUHDGVXQGHUWKHVXSSRUWV 3$57 (;(&87,21 522)+$7&+6$)(7<5$,/ $ 0HDVXUHFXUEWRHQVXUHSURSHUILWWLQJ % 6HWFXUEIDPLQJJDVNHWDURXQGURRIRSHQLQJDQGWLJKWHQWRILWRSHQLQJ & ,QVWDOOWKHFRUQHUSRVWVDQGEROWWRIUDPH ' ,QVWDOOFURVVUDLOVLQWRFODPSVDQGOHYHODGMXVW ( ,QVWDOOVHOIFORVLQJJDWH ) )ROORZWKHPDQXIDFWXUHU¶VLQVWUXFWLRQVDQGUHFRPPHQGDWLRQV ),(/'48$/,7<&21752/ $ 7KH&RQWUDFWRULVUHVSRQVLEOHIRULQLWLDWLQJDQGPDLQWDLQLQJGDLO\H[HFXWLRQRIDTXDOLW\ FRQWUROSURJUDPWKDWZLOOLQFOXGHEXWLVQRWOLPLWHGWRVXSHUYLVLRQE\WKHMREIRUHPDQRU VXSHUYLVRUGXULQJPHDVXUHPHQWVIRUIDEULFDWLRQVXEVWUDWHSUHSDUDWLRQDQGLQVWDOODWLRQRI DFFHVVRU\FRPSRQHQWV % &RUUHFWGHIHFWVDQGLUUHJXODULWLHVDVGLUHFWHGE\'HVLJQHURU2ZQHU¶VUHSUHVHQWDWLYH & &RQWUDFWRUVKDOOSODQVHTXHQFHRIZRUNWRSUHYHQWGDPDJHVWRH[LVWLQJPDWHULDOVWRUHPDLQ LQWHULRUFRPSRQHQWVRUQHZUHSODFHPHQWURRIV\VWHP ' 6LJQLILFDQWDEUDVLRQVVFUDWFKHVVFUDSHVHWFLQILQLVKHGPHWDOVXUIDFHVPD\UHVXOWLQ UHMHFWLRQE\WKH'HVLJQHUDQGUHTXLUHUHPRYDODQGUHSODFHPHQW DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)$&&(6625,(6 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW -2%$1':($7+(5&21',7,216 $ 6XVSHQGDOODSSOLFDWLRQDQGLQVWDOODWLRQDFWLYLWLHVGXULQJLQFOHPHQWZHDWKHU % 3URWHFWDGMDFHQWEXLOGLQJVXUIDFHVDJDLQVWGDPDJH & 5HPRYHGHEULVIURPURRIDQGVLWHRQDGDLO\EDVLVDQGGLVSRVHDWDQDSSURYHGGLVSRVDOVLWH ' /LPLWWUDIILFRYHUFRPSOHWHGURRIVXUIDFHVDQGSURYLGHSURWHFWLRQIURPHTXLSPHQWZRUNHU WUDIILFDQGPDWHULDOVGXULQJLQVWDOODWLRQ (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±3$,17,1* 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 3$,17,1* 3$57*(1(5$/ :25.,1&/8'(' $ 3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRUFOHDQLQJDQGSDLQWLQJH[LVWLQJ ODGGHUHTXLSPHQWVXSSRUWV$OWHUQDWH%LGJDVOLQHV$OWHUQDWH%LGFODPSLQJULQJVDQGGUDLQ VWUDLQHUVDQGRWKHUPLVFHOODQHRXVPHWDOLWHPDWORFDWLRQVQRWHGRQWKHGUDZLQJV 68%0,77$/6 $ 6XEPLWPDQXIDFWXUHU¶VODWHVWOLWHUDWXUHDQGVSHFLILFDWLRQVIRUSURGXFWVXVHGLQFOXGLQJVXUIDFH SUHSDUDWLRQDQGLQVWDOODWLRQLQVWUXFWLRQV % 6XEPLWVDPSOHVRISDLQWFRORUIRU2ZQHUVHOHFWLRQRIFRORU :$55$17< $ ,QDGGLWLRQWRWKH&RQWUDFWRU¶V)LYH<HDUZDUUDQW\VSHFLILHGLQ6HFWLRQSURYLGHWKHFRDWLQJ PDQXIDFWXUHU¶VVWDQGDUGZDUUDQW\DJDLQVWGHIHFWVRIPDWHULDOVDQGZRUNPDQVKLSEHJLQQLQJZLWK GDWHRIILQDOFRPSOHWLRQ 3$57352'8&76 0$7(5,$/6 $ &RDWLQJIRU1RQJDOYDQL]HGVWHHODQGZRRGFRDWVPLQLPXPRIPLOVGU\ILOPWKLFNQHVVSHUFRDW 3URYLGHSULPHUVDVUHFRPPHQGHGE\WKHPDQXIDFWXUHU&RORUWREHDSSURYHGE\WKH(QJLQHHUDQG 2ZQHU$FFHSWDEOHSURGXFWVDQGPDQXIDFWXUHUVLQFOXGH,PSHUYH[/DWH[+LJK*ORVV0HWDODQG:RRG (QDPHOE\%HQMDPLQ0RRUHDQG&R$OO6XUIDFH(QDPHO/DWH[%DVHE\6KHUZLQ:LOOLDPVRU DSSURYHGHTXDO3URYLGHSULPHUUHFRPPHQGHGUHTXLUHGE\PDQXIDFWXUHU&RORUIRUJDVSLSHVLVWREH \HOORZ % 5XVW,QKLELWLYH3ULPHU3URYLGHDVROYHQWIUHHPRLVWXUHWROHUDQWSURGXFWVSHFLILFDOO\IRUPXODWHG DVDQDQWLFRUURVLRQFRDWLQJFRDWVPLOVWRWDOGU\ILOPWKLFNQHVVPLQLPXP3URYLGHSULPHU DVUHFRPPHQGHGE\WKHPDQXIDFWXUHU$FFHSWDEOHSURGXFWDQGPDQXIDFWXUHULQFOXGHVEXWLVQRW OLPLWHGWR6XSHU6SHF+3$ON\G0HWDO3ULPHU3E\%HQMDPLQ0RRUHDQG&R & 2WKHU6XEVWUDWHV3ULPHUVDQG)LQLVKFRDWLQJVDVUHFRPPHQGHGE\WKHFRDWLQJPDQXIDFWXUHUIRU VXEVWUDWH DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±3$,17,1* 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 27+(50$7(5,$/6 $ 3URYLGH RWKHU PDWHULDOV QRW VSHFLILFDOO\ GHVFULEHG EXW UHTXLUHG IRU D FRPSOHWH DQG SURSHU LQVWDOODWLRQDVVHOHFWHGE\WKH&RQWUDFWRUVXEMHFWWRUHYLHZRIWKH(QJLQHHU 3$57(;(&87,21 685)$&(&21',7,216 $ ([DPLQHWKHDUHDVDQGFRQGLWLRQVXQGHUZKLFKZRUNRIWKLVVHFWLRQZLOOEHSHUIRUPHG&RUUHFW FRQGLWLRQV GHWULPHQWDO WR WLPHO\ DQG SURSHU FRPSOHWLRQ RI WKH ZRUN 'R QRW SURFHHG XQWLO XQVDWLVIDFWRU\FRQGLWLRQVDUHFRUUHFWHG 0$7(5,$/635(3$5$7,21 $ 0L[ DQG SUHSDUH PDWHULDOV LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHU¶V UHFRPPHQGDWLRQV :KHQ PDWHULDOVDUHQRWLQXVHVWRUHLQWLJKWO\FRYHUHGFRQWDLQHUV0DLQWDLQFRQWDLQHUVXVHGLQVWRUDJH PL[LQJDQGDSSOLFDWLRQRISDLQWLQDFOHDQFRQGLWLRQIUHHIURPIRUHLJQPDWHULDOVDQGUHVLGXH % 6WLUPDWHULDOVEHIRUHDSSOLFDWLRQSURGXFLQJDPL[WXUHRIXQLIRUPGHQVLW\ 685)$&(35(3$5$7,21 $ 3HUIRUP SUHSDUDWLRQ DQG FOHDQLQJ SURFHGXUHV LQ DFFRUGDQFH ZLWK WKHPDQXIDFWXUHU¶V UHFRPPHQGDWLRQV3URYLGHSURWHFWLRQIRUDGMDFHQWLWHPVDQGILQLVKHVWKDWDUHQRWUHFHLYLQJFRDWLQJ % :LUHEUXVKWRUHPRYHDQ\UXVWDQGVXUIDFHFRUURVLRQSULRUWRFOHDQLQJ&OHDQHDFKVXUIDFHWREH SDLQWHGSULRUWRSDLQWDSSOLFDWLRQWRUHPRYHSUHYLRXVURRIV\VWHPPDWHULDOVVHDODQWVIODVKLQJ PDVWLF HWF 6FKHGXOH WKH FOHDQLQJ DQG SDLQWLQJ VR WKDW GXVWDQG RWKHU FRQWDPLQDQWV IURP FRQVWUXFWLRQZLOOQRWIDOORQWRZHWRUQHZO\FRDWHGVXUIDFHV8VHKDQGZLUHEUXVKHVWRUHPRYHG UXVWDQGVXUIDFHFRUURVLRQRQWKHJDVSLSH'RQRWXVHSRZHUWRROVWRFOHDQJDVSLSHVXQOHVVDOORZHG DQGUHFRPPHQGHGE\WKHORFDOFRGHDQGJDVFRPSDQ\ ),(/'7(67$33/,&$7,21 $ 3URYLGHDWHVWDSSOLFDWLRQRISULPHUDQGILQLVKFRDWRQVDPSOHSULRUWRSURFHHGLQJZLWKFRDWLQJ ZRUNWRYHULI\DGKHVLRQ % 3URYLGHDGKHVLRQWHVWLQDFFRUGDQFHZLWKPDQXIDFWXUHU¶VLQVWUXFWLRQV & 2EWDLQDSSURYDOIURP(QJLQHHUDQG2ZQHUSULRUWRSURFHHGLQJZLWKFRDWLQJZRUN ,167$//$7,21 $ *HQHUDO$SSO\LQDFFRUGDQFHZLWKPDQXIDFWXUHU¶VLQVWDOODWLRQLQVWUXFWLRQVODWHVWHGLWLRQ % 'U\LQJ$OORZVXIILFLHQWGU\LQJWLPHEHWZHHQFRDWVPRGLI\LQJWKHSHULRGDVUHFRPPHQGHGE\ WKHPDWHULDOPDQXIDFWXUHUWRVXLWDGYHUVHZHDWKHUFRQGLWLRQV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±3$,17,1* 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW & %UXVKRXWDQGZRUNWKHEUXVKFRDWVRQWRWKHVXUIDFHLQDQHYHQILOP ' &ORXGLQHVVVSRWWLQJKROLGD\VODSVEUXVKPDUNVUXQVVDJVDQGRWKHUVXUIDFHLPSHUIHFWLRQVZLOO QRWEHDFFHSWDEOH (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)$//3527(&7,216<67(06 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 )$//3527(&7,216<67(06 3$57*(1(5$/ :25.,1&/8'(' $ 3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRULQVWDOODWLRQRIQHZURRIPRXQWHG IDOOSURWHFWLRQDQFKRU % 3URYLGHRWKHUDFFHVVRULHVQRWVSHFLILFDOO\OLVWHGKHUHLQEXWDVVKRZQRQWKH3URMHFW'UDZLQJVRU DVUHTXLUHGE\WKHV\VWHPPDQXIDFWXUHUIRUWKHFRPSOHWHDQGSURSHULQVWDOODWLRQRIWKHZRUN 5()(5(1&(6 1RUWK&DUROLQD%XLOGLQJ&RGH/DWHVW(GLWLRQ 26+$)DOO3URWHFWLRQ*XLGHOLQHV&)5GDQG&)5 1DWLRQDO5RRILQJ&RQWUDFWRUV$VVRFLDWLRQ15&$ 6KHHW0HWDODQG$LU&RQGLWLRQLQJ&RQWUDFWRUV1DWLRQDO$VVRF60$&1$ 48$/,7<$6685$1&( $ )DOOSURWHFWLRQV\VWHPPDQXIDFWXUHUWRKDYHPLQLPXP\HDUVGRFXPHQWHGH[SHULHQFHLQWKHGHVLJQ DQGIDEULFDWLRQRIVSHFLILFIDOOSURWHFWLRQV\VWHPW\SHVWREHLQVWDOOHG % )DOO SURWHFWLRQ V\VWHP LQVWDOOHU LI QRW WKH PDQXIDFWXUHU PXVW KDYH D PLQLPXP RI \HDUV GRFXPHQWHGH[SHULHQFHLQWKHLQVWDOODWLRQRIURRIWRSDQGZDOOPRXQWHGIDOOSURWHFWLRQDQFKRUDJH V\VWHPV & :HOGHUVLQYROYHGLQWKHLQVWDOODWLRQRIIDOOSURWHFWLRQDQFKRUVPXVWEHFHUWLILHGLQDFFRUGDQFHZLWK $:6 ' :HOGV PXVW EH YLVXDOO\ LQVSHFWHG E\ D &HUWLILHG :HOGLQJ ,QVSHFWRU &:, LQ DFFRUGDQFHZLWK$:6$FRS\RIWKHLQVSHFWLRQUHSRUWPXVWEHSURYLGHGWRWKH'HVLJQHU7KH FRVWRIWKHZHOGLQJLQVSHFWLRQZLOOEHERUQHE\WKH&RQWUDFWRU 68%0,77$/6 $ 3ULRUWRVWDUWLQJZRUNVXEPLWPDQXIDFWXUHU¶VZULWWHQSURGXFWGDWDVSHFLILFDWLRQVLQFOXGLQJORDG UDWLQJVDJHQF\DSSURYDOVDQGLQVWDOODWLRQLQVWUXFWLRQVIRUPDWHULDOVDQGSURGXFWVWREHLQVWDOOHGWR FRQILUPFRQIRUPDQFHZLWKSURMHFWUHTXLUHPHQWV % 6XEPLWVKRSGUDZLQJVVHDOHGE\D1RUWK&DUROLQDUHJLVWHUHGSURIHVVLRQDOHQJLQHHUVKRZLQJIDOO SURWHFWLRQV\VWHPGHVLJQLQFOXGLQJWKHIROORZLQJDOD\RXWGUDZLQJVKRZLQJORFDWLRQDQGVSDFLQJ RIURRIDQGZDOODQFKRUVDQGURSHVWRSVLIDSSOLFDEOH,QFOXGHGHWDLOGUDZLQJVRIIDOOSURWHFWLRQ V\VWHPFRPSRQHQWVVKRZLQJDWWDFKPHQWWRVWUXFWXUH6KRZGHWDLOVRIFRQQHFWLRQVDWPHWDOGHFN FHPHQWLWLRXVGUDLQDJHILOODQGSUHFDVW,QGLFDWHPDWHULDOVJUDGHVDQGSDUWFRXQWTXDQWLWLHVRQ GUDZLQJV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)$//3527(&7,216<67(06 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW & 3URYLGHOHWWHUIURPWKHV\VWHPPDQXIDFWXUHULQGLFDWLQJUHYLHZDQGDSSURYDORIWKHFRQWUDFWRUVVKRS GUDZLQJVDQGDFFHSWDQFHRIGHVLJQLQWHQWDQGGHWDLOV ' 3URYLGHOHWWHUIURPWKHV\VWHPPDQXIDFWXUHUVWDWLQJLQWHQWWRLVVXHWKHVSHFLILHGPDWHULDOZDUUDQW\ /HWWHUVKDOOEHSURMHFWVSHFLILFDQGVKDOOLQFOXGHWKHW\SHDQGGXUDWLRQRIZDUUDQW\DQ\PDQXIDFWXUHU¶V DGGLWLRQDOUHTXLUHPHQWVDQGDVDPSOHFRS\RIDFWXDOZDUUDQW\LQFOXGLQJPDWHULDOVDQGZRUNPDQVKLS ( 8SRQFRPSOHWLRQRISURMHFWSURYLGH2ZQHUZLWK/RJ%RRNIRUPDQGDWRU\DQQXDOLQVSHFWLRQDQG VLJQHGFRSLHVRIUHTXLUHGZDUUDQWLHV3URYLGH2ZQHUZLWKLQVWDOODWLRQORDGWHVWYHULILFDWLRQUHVXOWV 3URYLGHVLJQDJHWREHLQVWDOOHGDWHQWUDQFHSRLQWWRURRIVWDWLQJWKHV\VWHPORDGUDWLQJVLQVSHFWLRQ GDWHVRSHUDWLQJUHTXLUHPHQWVDQGZDUQLQJV ) 8SRQFRPSOHWLRQRISURMHFWSURYLGH2ZQHUZLWK ³DVEXLOW´URRISODQVKRZLQJOD\RXWRIIDOO SURWHFWLRQDQFKRUV\VWHP :$55$17< $ 3URYLGHV\VWHPPDQXIDFWXUHU¶VVWDQGDUGZDUUDQW\DJDLQVWGHIHFWVRIPDWHULDOVDQGZRUNPDQVKLS7KH PDQXIDFWXUHU¶VZDUUDQW\VKDOOQRWUHSODFHRUYRLGWKH&RQWUDFWRU¶V)LYH<HDU:DUUDQW\IRULQVWDOOHG ZRUN 3$57352'8&76 522)$1&+256$1'+$5':$5( $ 5RRIDQFKRUSRVW7\SHVWDLQOHVVVWHHOIRUJHGH\HZLWKXUHWKDQHLQVXODWHGKROORZW\SH* JDOYDQL]HGVWHHOSRVWZLWKZDOOWKLFNQHVV[PLQRXWVLGHGLDPHWHUZHOGHGWR´[´[ ´WKLFNW\SH*JDOYDQL]HGVWHHOEDVHSODWH+HLJKWRISRVWYDULHVGHSHQGLQJXSRQURRIORFDWLRQ DQGV\VWHPWKLFNQHVV5HIHUWRGUDZLQJVIRUORFDWLRQVDQGFRRUGLQDWHZLWKURRILQJFRQWUDFWRUWR FRQILUPDQWLFLSDWHGURRIV\VWHPWKLFNQHVVDWDQFKRUORFDWLRQV$Q\KROHVLQWKHDQFKRUSRVWPXVW EHILOOHGDQGORFDWHGORZRQWKHDQFKRUVRDVWRSUHYHQWH[SRVXUHWRLQFOLPDWHZHDWKHU % $FFHSWDEOHIDEULFDWRUVPDQXIDFWXUHUVRIURRIDQFKRUSRVWVLQFOXGHEXWDUHQRWOLPLWHGWR7KDOHU 0HWDO86$352%(/(QWHUSULVHV%ODFNSLQ,QGXVWULHV3HDN)DOO3URWHFWLRQRUDSSURYHGHTXDO & 7KH OLVWHG PDQXIDFWXUHUV DUH SURYLGHG DV H[DPSOHV RI PDQXIDFWXUHUV WKDW W\SLFDOO\ PHHW WKH UHTXLUHPHQWVRIWKHVHVSHFLILFDWLRQV7KHOLVWHGPDQXIDFWXUHUVDUHDFFHSWDEOHRQO\LIWKH\DUHDEOH WRPHHWWKHUHTXLUHPHQWVRIWKHVSHFLILFDWLRQV7KHFLWHGH[DPSOHVDUHXVHGWRGHQRWHWKHTXDOLW\ VWDQGDUGRISURGXFWGHVLUHGDQGGRQRWUHVWULFWELGGHUVWRDVSHFLILFPDQXIDFWXUHUEUDQGRUPDNH 5HTXHVWVIRUVXEVWLWXWLRQVRIDQRWKHUHTXLYDOHQWPDQXIDFWXUHURUSURGXFWPXVWEHVXEPLWWHGLQ ZULWLQJWRWKH(QJLQHHUIRUDSSURYDORUGLVDSSURYDOQROHVVWKDQGD\VSULRUWRWKHELGGDWH 6XEPLWWHG UHTXHVWV PXVW LQFOXGH VXIILFLHQW GDWD DQG GRFXPHQWDWLRQ WR LQGLFDWH WKDW WKH PDQXIDFWXUHU DQG SURGXFW VXEPLWWHG PHHWV WKH UHTXLUHPHQWV RI WKHVH VSHFLILFDWLRQV DQG DUH HTXLYDOHQWWRWKHTXDOLW\RIWKRVHOLVWHG ' 6\VWHP3HUIRUPDQFH5HTXLUHPHQWVWKHQHZIDOODUUHVWDQFKRUDJHV\VWHPPXVWFRQIRUPWRWKH IROORZLQJ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)$//3527(&7,216<67(06 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 26+$ &)5 DQG &)5 26+$ 6XESDUW 0 )DOO 3URWHFWLRQ $QFKRUVPXVWEHSUHPDQXIDFWXUHGDQGPXVWEHFDSDEOHRIVXSSRUWLQJDZRUNLQJORDGRI OEVPLQLPXPDQGVKDOOUHVLVWZLWKRXWIUDFWXUHDPLQLPXPSXOORXWIRUFHRI OEVZKHQDSSOLHGLQWKHPRVWDGYHUVHGLUHFWLRQ 3$57±(;(&87,21 '(02/,7,21 $ )LHOGYHULI\WKHLQIRUPDWLRQSURYLGHGLQWKHGHVLJQGRFXPHQWVIRUWKHURRIVWUXFWXUHDVVRFLDWHGZLWK VXSSRUWRIWKHURRIDQGZDOOPRXQWHGDQFKRUV/RFDWHVWUXFWXUHIURPEHORZWKHDQFKRUORFDWLRQ % &RRUGLQDWHZLWKWKH*HQHUDO&RQWUDFWRUDQG5RRILQJ6XEFRQWUDFWRUSULRUWRDQ\FXWWLQJRIWKHURRI V\VWHPRUURRIGHFNIRULQVWDOODWLRQWRHQVXUHWKDWSURSHULQWHULRUSURWHFWLRQDQGSURWHFWLRQRIWKHURRI V\VWHPKDYHEHHQSURYLGHGLQDFFRUGDQFHZLWK6HFWLRQ2SHQLQJVPDGHLQWKHURRIV\VWHP ZLOOUHTXLUHUHSDLUWRGHFNLQJDQGURRIV\VWHPWRUHWXUQWKHV\VWHPWRDZDWHUWLJKWFRQGLWLRQSULRUWR WKHHQGRIWKHZRUNGD\RUEHIRUHLQFOHPHQWZHDWKHU & 3URYLGHVKRSGUDZLQJVLQDFFRUGDQFHZLWK6HFWLRQDQGWKLVVSHFLILFDWLRQVHFWLRQ'RQRW SURFHHGZLWKIDEULFDWLRQDQGLQVWDOODWLRQRIDQFKRUVDQGVXSSOHPHQWDOIUDPLQJXQWLOVKRSGUDZLQJV KDYHEHHQUHYLHZHGDQGDSSURYHGE\WKH'HVLJQHU ' 5HPRYHWKHH[LVWLQJIDOOSURWHFWLRQDQFKRUVDQGLQVWDOOQHZDQFKRUVDWRUQHDUWKHH[LVWLQJORFDWLRQV ( 5HPRYHGHFNLQJPDWHULDOIURPVWHHOVXEVWUXFWXUHDVQHFHVVDU\WRDOORZIRUSURSHULQVWDOODWLRQRI DQFKRUSRVWVWKURXJKZHOGLQJRUEROWLQJDURXQGH[LVWLQJIUDPLQJ ,167$//$7,21 $ :KHUHEROWLQJLVXVHGIRUIDVWHQLQJDQFKRUVQRIHZHUWKDQWZRWKUHDGVVKDOOEHH[SRVHGDQGWKH QXWLVWREHSRVLWLYHO\ORFNHGE\GHIRUPLQJWKUHDGVZHOGLQJSLQQLQJRUHTXLYDOHQWPHWKRG)XOO\ WLJKWHQEROWVWRPDQXIDFWXUHU¶VWRUTXHUHTXLUHPHQWV % :KHQZHOGLQJLVXVHGIRUIDVWHQLQJDQFKRUVIROORZSURWHFWLRQUHTXLUHPHQWVIRUEXLOGLQJLQWHULRU LQDFFRUGDQFHZLWKWKHVHVSHFLILFDWLRQV:HOGVPXVWEHYLVXDOO\LQVSHFWHGE\D&HUWLILHG:HOGLQJ ,QVSHFWRU&:,LQDFFRUGDQFHZLWK$:6$FRS\RIWKHLQVSHFWLRQUHSRUWPXVWEHSURYLGHGWRWKH 'HVLJQHU & 5HSDLUWKHURRIGHFNLQJDQGWHPSRUDU\V\VWHPDURXQGURRIDQFKRULQVWDOODWLRQ,QVWDOOJDXJH JDOYDQL]HGPHWDOSODWHDURXQGSHQHWUDWLRQ3ODWHVKDOOH[WHQGDPLQLPXPRI´RQWRDGMDFHQWGHFN ,QVWDOOSODWHDWWLPHRIIDOOSHQHWUDWLRQLQVWDOODWLRQ0DNHUHSDLUVLQDFFRUGDQFHZLWKVKRSGUDZLQJV UHIHUHQFHGVWDQGDUGVDVZHOODVDSSOLFDEOHVHFWLRQVRIWKHVHVSHFLILFDWLRQV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±)$//3527(&7,216<67(06 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 7(67,1*2),13/$&($1&+256 $ 5RRIDQFKRUVVKDOOEHLQVSHFWHGE\DTXDOLILHGWHVWLQJDJHQF\FRRUGLQDWHGDQGSDLGIRUE\WKH &RQWUDFWRUXSRQFRPSOHWLRQRIDQFKRULQVWDOODWLRQ,QVSHFWLRQVKDOOLQFOXGHDVWDWLFORDGWHVW 'RFXPHQWHGWHVWUHVXOWVPXVWEHSURYLGHGWRWKH'HVLJQHUDQG2ZQHU¶VUHSUHVHQWDWLYH % 6WDWLFORDGWHVWVKDOOLPSRVHDZRUNLQJORDGRQHDFKDQFKRU([DFWORDGDQGWHVWPHWKRGVKDOOEH DVUHFRPPHQGHGE\WKHDQFKRUPDQXIDFWXUHUVXSSOLHU,IPDQXIDFWXUHUGRHVQRWKDYHWHVWPHWKRGV REWDLQWHVWYDOXHVDQGPHWKRGVIURPWKH'HVLJQHU/RDGVKDOOEHDSSOLHGSHUSHQGLFXODUWRH\HRI DQFKRU & 7HVWLQJPXVWEHFRPSOHWHGSULRUWRWKHLQVWDOODWLRQRIWKHSULPDU\URRIV\VWHPIRUURRIPRXQWHG DQFKRUV$QFKRUVWKDWIDLOGXULQJWHVWLQJPXVWEHUHSODFHGE\WKHFRQWUDFWRUDWQRFRVWWRWKH 2ZQHU ),(/'48$/,7<&21752/ $ 7KH&RQWUDFWRULVUHVSRQVLEOHIRULQLWLDWLQJDQGPDLQWDLQLQJGDLO\H[HFXWLRQRIDTXDOLW\FRQWURO SURJUDPWKDWZLOOLQFOXGHEXWLVQRWOLPLWHGWRVXSHUYLVLRQE\WKHMREIRUHPDQRUVXSHUYLVRUGXULQJ GHPROLWLRQOD\RXWDQGLQVWDOODWLRQRIDQFKRUVURSHVWRSVZDUQLQJOLQHDQGRWKHUIDOOSURWHFWLRQ FRPSRQHQWVWHVWLQJDQGSURELQJRIKHDWZHOGLQJ % &RUUHFWGHIHFWVDQGLUUHJXODULWLHVDVGLUHFWHGE\(QJLQHHURU2ZQHU¶VUHSUHVHQWDWLYH (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)'5$,16 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 522)'5$,16 3$57 *(1(5$/ :25.,1&/8'(' $ 5RXWH[LVWLQJRYHUIORZGUDLQWRRXWHUZDOODVVKRZQRQWKHGUDZLQJV (19,5210(17$/&21',7,216 $ 0DWHULDOV LQVWDOODWLRQ VKDOO SURFHHG RQO\ ZKHQ ZHDWKHU FRQGLWLRQV DUH LQ FRPSOLDQFH ZLWK WKH DSSOLFDEOH PDQXIDFWXUHU V UHFRPPHQGDWLRQV IRU LQVWDOODWLRQ DQGQR SUHFLSLWDWLRQ LV LPPLQHQW 0DWHULDOVLQVWDOOHGGXULQJDGYHUVHZHDWKHUFRQGLWLRQVVKDOOEHVXEMHFWWRUHMHFWLRQLQFOXGLQJUHPRYDO DQGUHSODFHPHQW 68%0,77$/6 $6XEPLWPDQXIDFWXUHULQIRUPDWLRQRQGUDLQV39&SLSLQJHOERZVFRQQHFWLRQVDQGDFFHVVRULHV % 6XEPLWVKRSGUDZLQJVIRUSLSHURXWHVDQGFRQQHFWLRQV 3$57 352'8&76 $&&(37$%/(0$18)$&785(56 $ -RVDP0DQXIDFWXULQJ&RPSDQ\=XUQ,QGXVWULHVDQG-56PLWK % 6XEVWLWXWLRQV,WHPVRIWKHVDPHIXQFWLRQDQGSHUIRUPDQFHDUHDFFHSWDEOHLQDFFRUGDQFHZLWK6HFWLRQ 0$7(5,$/6±522)'5$,1$1'3,3(5(3/$&(0(17 $5RRI'UDLQV6KDOOEHVLPLODURUDSSURYHGHTXDOWR=XUQ=FRDWHGFDVWLURQURRIGUDLQKDYLQJ ODUJHFDVWLURQORFNLQJGRPHDQGVWHHOGHFNFODPS6L]HVVKDOOEH %2YHUIORZ'UDLQV6KDOOEHVLPLODURUDSSURYHGHTXDOWR=XUQ=FRDWHGFDVWLURQURRIGUDLQDQG VWHHOGHFNFODPS6L]HVKDOOEH &'UDLQDJH3LSH3LSHVKDOOEH&39&DQGZUDSSHGZLWKILUHUDWHGLQVXODWLRQRU&DVW,URQ3URYLGH VWUDLJKWSLSHHOERZVVZHHSVILWWLQJVHWFDVQHHGHG6L]HDVQRWHGRQWKHGUDZLQJVRUWRPDWFKH[LVWLQJ EHLQJUHSODFHG '3LSH+DQJHUV6KDOOFRQVLVWRIDVWHHOFOHYLVEHDPFODPSDQGFRQWLQXRXVWKUHDGHGGLDPHWHU URG DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)'5$,16 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW (3LSH6WUDS)DVWHQHUV6KDOOEHVWDLQOHVVVWHHOKH[KHDGVOHHYHDQFKRUVVXFKDV66DV PDQXIDFWXUHGE\+LOWL )3LSH&ODPSV6KDOOEHVLPLODUWR%2IIVHW3LSH&ODPSPDQXIDFWXUHGE\&RRSHU&ODPSVDUH WREHSDLQWHGWRPDWFKWKHH[LVWLQJZDOOFRORU *3LSHLQVXODWLRQVKDOOEHILEHUJODVVLQVXODWLRQZLWKDYDSRUUHWDUGHUIDFLQJ$OOQHZSLSHVVKDOOEH LQVXODWHGXQOHVVRWKHUZLVHDSSURYHGE\WKH'HVLJQHU +2YHUIORZ'LVFKDUJH1R]]OH6KDOOEHEURQ]HZLWKDZDOOIODQJHVLPLODUWRDVPDQXIDFWXUHGE\ -56PLWK ,6WUXFWXUDO6WHHO6KDOOFRQIRUPWR$670$DQGWKH$PHULFDQ,QVWLWXWHRI6WHHO&RQVWUXFWLRQ $,6& -%ROWV6KDOOFRQIRUPWR$670$ .)LUH5DWHG6HDODQW6KDOOEHDILUHUDWHGVHDODQWWRPHHW8/UHTXLUHPHQWWRPDLQWDLQH[LVWLQJILUHZDOO UDWLQJ6LPLODUWR$&)75DVPDQXIDFWXUHGE\3HFRUD7REHXVHGLQFRQMXQFWLRQZLWKILUHEORFNLQJ PDWHULDO /0LVFHOODQHRXV&DVWLURQGUDLQH[WHQVLRQULQJVGRPHVFODPSLQJULQJV 3$57 (;(&87,21 ,167$//$7,21*(1(5$/ $ &RQWUDFWRUVKDOOUHPRYHH[LVWLQJILUHZDOODQGGUDLQSLSHSDVWWKHILUVWHOERZ1RWH5HPRYHGUDLQ ERZODVVHOHFWHGE\WKH2ZQHU % &RQWUDFWRUVKDOOLQVWDOOSLSHVDQGDFFHVVRULHV,QVWDOOGUDLQERZODVUHTXLUHG&RQWUDFWRUVKDOOEH UHVSRQVLEOHIRUFXWWLQJDQGUHSDLULQJGHFNRUJ\SVXPFHLOLQJ & 'LPHQVLRQVDQGORFDWLRQVRQSODQVDUHDSSUR[LPDWLRQVDQGVKRXOGEHILHOGYHULILHGE\WKH&RQWUDFWRU EHIRUHSURFHHGLQJZLWKZRUN ' ,QVWDOOQHZSLSHDQGGUDLQVLQDFFRUGDQFHZLWKPHPEUDQHPDQXIDFWXUHU VUHFRPPHQGDWLRQVDQGGHWDLO GUDZLQJV ) 2EWDLQKRWZRUNSHUPLWDVDSSOLFDEOH '5$,16$1'3,3( $ ,QVWDOOQHZSLSHVDWORFDWLRQVKRZQRQWKHGUDZLQJV DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ±522)'5$,16 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW % $GGLWLRQDOVWHHOIUDPLQJWRVXSSRUWQHZGUDLQLVQRWWREHLQFOXGHGLQWKHXQLWFRVWEXWQRWLI\WKH 2ZQHULIUHTXLUHG,IDGGLWLRQDOVWHHOIUDPLQJLVUHTXLUHGLWVKDOOEHSDLQWHGLQFRPSOLDQFHZLWK6WHHO 6WUXFWXUHV3DLQWLQJ&RXQFLO663&631HDU:KLWH0HWDO%ODVW&OHDQLQJ6WHHOZRUNVKDOOEH SDLQWHGZLWKRQHVKRSFRDWRIUXVWLQKLELWLYHSULPHU3DLQWVKDOOEHDSSOLHGWRDOOEROWVFRQQHFWLRQV GDPDJHGVSRWV & ,IUHTXLUHGLQVWDOOQHZVWHHODQJOHWRVXSSRUWGUDLQERZOLQDFFRUGDQFHZLWKWKH$PHULFDQ,QVWLWXWHRI 6WHHO&RQVWUXFWLRQ$,6&6SHFLILFDWLRQIRUWKH'HVLJQ)DEULFDWLRQDQG(UHFWLRQRI6WUXFWXUDO6WHHO IRU%XLOGLQJVDQG%ULGJHVODWHVWHGLWLRQKHUHLQDIWHUUHIHUUHGWRDVWKH$,6&6SHFLILFDWLRQDQGWKH $,6&&RGHRI6WDQGDUG3UDFWLFHIRU6WHHO%XLOGLQJVDQG%ULGJHVODWHVWHGLWLRQVKDOOJRYHUQWKH ZRUN:HOGLQJVKDOOEHLQDFFRUGDQFHZLWK$PHULFDQ:HOGLQJ6RFLHW\$:66WUXFWXUDO:HOGLQJ &RGH6WHHO'KHUHLQDIWHUUHIHUUHGWRDVWKH$:6&RGH+LJKVWUHQJWKEROWLQJVKDOOEHLQ DFFRUGDQFHZLWK5HVHDUFK&RXQFLORQ6WUXFWXUDO&RQQHFWLRQV5&6&6SHFLILFDWLRQVIRU6WUXFWXUDO -RLQWV8VLQJ$670$RU$%ROWVODWHVWHGLWLRQ ' 6XSSRUWGUDLQSLSLQJZLWKSLSHKDQJHUVVSDFHGDWIHHWPD[LPXPSURYLGHPLQLPXPRIWZRKDQJHUV SHUOHQJWKRISLSH - $OOFHLOLQJVDQGZDOOVEUHDFKHGDVDUHVXOWRILQVWDOOLQJQHZGUDLQVDQGSLSLQJVKDOOEHUHSDLUHGZLWK OLNHPDWHULDOV0DLQWDLQFXUUHQWKRXUILUHZDOOVWDQGDUGVDQGUDWHGSHQHWUDWLRQ8/ILUH6HH8/ 6\VWHP1R:/IRUZDOODVVHPEO\DQGSHQHWUDWLRQ . 1HZLQWHULRUSLSHVKDOOEHLQVXODWHG / $WORFDWLRQVZKHUHSLSLQJLVGHVLJQDWHGWREUHDFKH[WHULRUZDOOVSURYLGHDSSURSULDWHVOHHYHVDQG ILWWLQJV (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 *(1(5$/0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 6(&7,21 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 3$57*(1(5$/ :25.,1&/8'(' $ 3URYLGH ODERU PDWHULDOV HTXLSPHQW DQG VXSHUYLVLRQ QHFHVVDU\ IRU LQVSHFWLRQ GLVFRQQHFWLRQ UHORFDWLRQUHLQVWDOODWLRQUHFRQQHFWLRQDQGUHFKDUJLQJRIH[LVWLQJURRIWRSHTXLSPHQWDQGDVVRFLDWHG H[WHQVLRQV RI DQGRU PRGLILFDWLRQV WR H[LVWLQJ PHFKDQLFDO FRQQHFWLRQV HOHFWULFDO FRQQHFWLRQV GXFWZRUNFRQWUROZLULQJRUSQHXPDWLFOLQHV7KLVZRUNLVDVVRFLDWHGZLWKUDLVLQJWKHH[LVWLQJXQLWV DQGLVRQO\UHTXLUHDVQHHGHGWRPDLQWDLQXQLWVLQRSHUDWLRQDOFRQGLWLRQDIWHUURRIUHSODFHPHQW % 3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRUGLVFRQQHFWLRQDQGWHUPLQDWLRQRI WKHH[LVWLQJVRODUSDQHOV$OOZRUNPXVWEHSHUIRUPHGE\DOLFHQVHGHOHFWULFDOFRQWUDFWRU & 3URYLGHODERUPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRULQVSHFWLRQRIUHSDLUVWRDQGDQ\ DVVRFLDWHGH[WHQVLRQVRIDQGRUPRGLILFDWLRQVWRH[LVWLQJHOHFWULFDOFRQWURODQGRURWKHUZLULQJ ' 3URYLGHPDWHULDOVHTXLSPHQWDQGVXSHUYLVLRQQHFHVVDU\IRURWKHUPLVFHOODQHRXVHOHFWULFDODQGRU PHFKDQLFDOZRUNQRWVSHFLILFDOO\OLVWHGEXWUHTXLUHGIRUFRPSOHWHDQGSURSHULQVWDOODWLRQRIWKHZRUN DVVSHFLILHGKHUHLQRUVKRZQRQWKHGUDZLQJV 48$/,7<$6685$1&( $ 3HUIRUPPHFKDQLFDODQGHOHFWULFDOZRUNLQDFFRUGDQFHZLWKWKHODWHVWDGRSWHGHGLWLRQVRIWKH1DWLRQDO 0HFKDQLFDO&RGHWKH1DWLRQDO(OHFWULFDO&RGH(3$1)3$DQGRWKHUDSSOLFDEOHORFDOUHJXODWLRQV % ,QDGGLWLRQWRFRPSOLDQFHZLWKODZVDQGUHJXODWLRQVVWDWHGLQ3DUDJUDSK$ZRUNVKDOOFRQIRUPWR DSSOLFDEOHVWDQGDUGVRI8/$60($16,DQGRWKHUDXWKRULWLHVRUDJHQFLHVWRZKLFKVSHFLILFUHIHUHQFH LVPDGHE\VSHFLILFDWLRQVDQGRUPDQXIDFWXUHU¶VLQVWDOODWLRQLQVWUXFWLRQV & 7KH&RQWUDFWRUVKDOOVHFXUHDQGSD\IRUDOOQHFHVVDU\SHUPLWVIHHVDQGLQVSHFWLRQVDQGSUHSDUHDOO GUDZLQJVUHTXLUHGE\DSSOLFDEOHVWDWHDQGORFDOFRGHV ' &KHFN DOO HTXLSPHQW WR HQVXUH LW LV LQ SURSHU ZRUNLQJ RUGHUSULRU WR FRQVWUXFWLRQ 1RWLI\ WKH 'HVLJQHU2ZQHURIDQ\HTXLSPHQWWKDWLVGDPDJHGRULVQRWLVZRUNLQJSURSHUO\$Q\HTXLSPHQW IRXQG WR EH GDPDJHG RU QRW LQ ZRUNLQJ RUGHU DIWHU WKH EHJLQQLQJ RI FRQVWUXFWLRQ ZLOO EH UHSDLUHGUHSODFHGE\WKH&RQWUDFWRUDWQRFRVWWRWKH2ZQHU :$55$17< $ ,IUHSODFHPHQWRIDQH[LVWLQJPHFKDQLFDOXQLWVRUHOHFWULFDOFRPSRQHQWVDWQRFRVWWRWKH2ZQHULV QHFHVVDU\ GXH WR GDPDJH GXULQJ FRQVWUXFWLRQ DFWLYLWLHV SURYLGH WKH HTXLSPHQW RU FRPSRQHQW PDQXIDFWXUHU¶VVWDQGDUGSURGXFWZDUUDQW\LQDGGLWLRQWRWKH&RQWUDFWRU¶VILYH\HDUZDUUDQW\DJDLQVW GHIHFWVRIPDWHULDOVDQGZRUNPDQVKLSEHJLQQLQJZLWKGDWHRIVXEVWDQWLDOFRPSOHWLRQ DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 *(1(5$/0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 3URMHFW0DQXDOIRU6SRUWVSOH[0DLQ%XLOGLQJ5RRI5HSODFHPHQW 2UDQJH&RXQW\+LOOVERURXJK1& 3UHSDUHGE\$WODV(QJLQHHULQJ,QF$3\ORQ'ULYH±5DOHLJK1& $XJXVW 3$57352'8&76 0$7(5,$/6 $ 3URYLGHPDWHULDOVDQGDFFHVVRULHVUHTXLUHGIRUDFRPSOHWHDQGSURSHULQVWDOODWLRQRIWKHZRUNDV VSHFLILHGKHUHLQDQGRQWKHSURMHFWGUDZLQJVLQDFFRUGDQFHZLWKDSSOLFDEOHORFDOVWDWHDQGIHGHUDO FRGHVDQGUHJXODWLRQV % 0DWHULDOVDQGHTXLSPHQWVKDOOEHDUFHUWLILFDWLRQRI8/$60(ZKHUHVXFKODEHOVDUHFXVWRPDU\ UHTXLUHGRUVSHFLILHG 3$57(;(&87,21 '2&80(17$7,212)(;,67,1*&21',7,21 $ 'RFXPHQWORFDWLRQVRIXQLWVSLSLQJFRQGXLWDQGRWKHUSHQHWUDWLRQVRQDVFKHPDWLFURRIOD\RXW ,167$//$7,21 $ ,I D XQLW LV UHSODFHG GXH WR GDPDJH GXULQJ FRQVWUXFWLRQ LQVWDOO QHZ XQLW LQ DFFRUGDQFH ZLWK PDQXIDFWXUHU¶VUHTXLUHPHQWV (1'2)6(&7,21 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 ANY PROPRIETOR/PARTNER/EXECUTIVE OFFICER/MEMBER EXCLUDED? INSR ADDL SUBR LTR INSD WVD PRODUCER CONTACT NAME: FAXPHONE (A/C, No):(A/C, No, Ext): E-MAIL ADDRESS: INSURER A : INSURED INSURER B : INSURER C : INSURER D : INSURER E : INSURER F : POLICY NUMBER POLICY EFF POLICY EXPTYPE OF INSURANCE LIMITS(MM/DD/YYYY)(MM/DD/YYYY) AUTOMOBILE LIABILITY UMBRELLA LIAB EXCESS LIAB WORKERS COMPENSATION AND EMPLOYERS' LIABILITY DESCRIPTION OF OPERATIONS / LOCATIONS / VEHICLES (ACORD 101, Additional Remarks Schedule, may be attached if more space is required) AUTHORIZED REPRESENTATIVE EACH OCCURRENCE $ DAMAGE TO RENTEDCLAIMS-MADE OCCUR $PREMISES (Ea occurrence) MED EXP (Any one person)$ PERSONAL & ADV INJURY $ GEN'L AGGREGATE LIMIT APPLIES PER:GENERAL AGGREGATE $ PRO-POLICY LOC PRODUCTS - COMP/OP AGGJECT OTHER:$ COMBINED SINGLE LIMIT $(Ea accident) ANY AUTO BODILY INJURY (Per person)$ OWNED SCHEDULED BODILY INJURY (Per accident)$AUTOS ONLY AUTOS HIRED NON-OWNED PROPERTY DAMAGE $AUTOS ONLY AUTOS ONLY (Per accident) $ OCCUR EACH OCCURRENCE CLAIMS-MADE AGGREGATE $ DED RETENTION $ PER OTH- STATUTE ER E.L. EACH ACCIDENT E.L. DISEASE - EA EMPLOYEE $ If yes, describe under E.L. DISEASE - POLICY LIMITDESCRIPTION OF OPERATIONS below INSURER(S) AFFORDING COVERAGE NAIC # COMMERCIAL GENERAL LIABILITY Y / N N / A (Mandatory in NH) SHOULD ANY OF THE ABOVE DESCRIBED POLICIES BE CANCELLED BEFORE THE EXPIRATION DATE THEREOF,NOTICE WILL BE DELIVERED IN ACCORDANCE WITH THE POLICY PROVISIONS. THIS IS TO CERTIFY THAT THE POLICIES OF INSURANCE LISTED BELOW HAVE BEEN ISSUED TO THE INSURED NAMED ABOVE FOR THE POLICY PERIOD INDICATED.NOTWITHSTANDING ANY REQUIREMENT,TERM OR CONDITION OF ANY CONTRACT OR OTHER DOCUMENT WITH RESPECT TO WHICH THIS CERTIFICATE MAY BE ISSUED OR MAY PERTAIN,THE INSURANCE AFFORDED BY THE POLICIES DESCRIBED HEREIN IS SUBJECT TO ALL THE TERMS, EXCLUSIONS AND CONDITIONS OF SUCH POLICIES. LIMITS SHOWN MAY HAVE BEEN REDUCED BY PAID CLAIMS. THIS CERTIFICATE IS ISSUED AS A MATTER OF INFORMATION ONLY AND CONFERS NO RIGHTS UPON THE CERTIFICATE HOLDER.THIS CERTIFICATE DOES NOT AFFIRMATIVELY OR NEGATIVELY AMEND,EXTEND OR ALTER THE COVERAGE AFFORDED BY THE POLICIES BELOW.THIS CERTIFICATE OF INSURANCE DOES NOT CONSTITUTE A CONTRACT BETWEEN THE ISSUING INSURER(S),AUTHORIZED REPRESENTATIVE OR PRODUCER, AND THE CERTIFICATE HOLDER. IMPORTANT:If the certificate holder is an ADDITIONAL INSURED,the policy(ies)must have ADDITIONAL INSURED provisions or be endorsed. If SUBROGATION IS WAIVED,subject to the terms and conditions of the policy,certain policies may require an endorsement.A statement on this certificate does not confer rights to the certificate holder in lieu of such endorsement(s). COVERAGES CERTIFICATE NUMBER:REVISION NUMBER: CERTIFICATE HOLDER CANCELLATION © 1988-2015 ACORD CORPORATION. All rights reserved.ACORD 25 (2016/03) CERTIFICATE OF LIABILITY INSURANCE DATE (MM/DD/YYYY) $ $ $ $ $ The ACORD name and logo are registered marks of ACORD Travis Ketron BARRO-2 OP ID: CS 10/28/2020 Cindy Smith Southeastern Agency Group,Inc. 1501 Highwoods Blvd., St # 402 Greensboro, NC 27410 Travis Ketron 336-232-0203 336-218-7487 csmith@sagnc.com Pennsylvania National Bridgefield Casualty Bar Roofing & Maintenance LLC 2237 Bethel Church Rd. Kernersville, NC 27284 A X 1,000,000 X GL9 0739179 07/06/2020 07/06/2021 100,000 5,000 1,000,000 2,000,000 2,000,000 1,000,000A X AU9 0739179 07/06/2020 07/06/2021 X X 1,000,000 XX 5,000,000A UL9 0739179 07/06/2020 07/06/2021 5,000,000 XB 0196-47278 07/20/2020 07/20/2021 1,000,000 Y 1,000,000 1,000,000 A IM90739179 07/06/2020 07/06/2021 270,000 A Rented & leased eq IM90739179 07/06/2020 07/06/2021 50,000 See page 2 ORACOUN Orange County PO Box 8181 Hillsborough, NC 27278 336-232-0203 14990 10335 UM/UIM Installation Float DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67 Date HOLDER CODE INSURED'S NAME PAGENOTEPAD: Certificate holder is automatically included as additional insured for General Liability, according to the terms, conditions & exclusions within the policy with respects to work performed by the insured on behalf of the certificate holder as required by written contract signed by an authorized representative of the named insured and the certificate holder ORACOUN 2 Bar Roofing & Maintenance LLC 10/28/2020 BARRO-2 OP ID: CS DocuSign Envelope ID: BFF4747D-7578-438D-BADC-CFCAAE0ECD67